KEGG   Drosophila persimilis: Dper_GL15372Help
Entry
Dper_GL15372      CDS       T01063                                 

Definition
(RefSeq) GL15372 gene product from transcript GL15372-RA
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dpe  Drosophila persimilis
Pathway
dpe00052  Galactose metabolism
dpe00500  Starch and sucrose metabolism
dpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dper_GL15372
   00500 Starch and sucrose metabolism
    Dper_GL15372
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dper_GL15372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 6595497
NCBI-ProteinID: XP_002020602
FlyBase: FBgn0152976
UniProt: B4GPS3
LinkDB All DBs
AA seq 564 aa AA seqDB search
MSSLVKSDAEDFIDWWQHTVFYQIYPRSFKDSNGDGIGDLPGITSKLQYLAETGITATWL
SPIFQSPMVDFGYDISDYRQIQPEYGTMEHFEQLIDKAYELGIKVILDFVPNHSSDEHEW
FKKSAAREPGYEDYYVWVDPKIDENGDRQPPNNWQSVFYGSAWEWHEGRQQYYLHQFTKE
QPDLNYRNPAVVQAMDDVILFWLNKGVAGFRIDAVNHMFEKESLEDEPLSGKTNDPLSYD
YTTHIYTKDLPEVLEMVQHWRQLLDDFSSKHPEGPTRIMMTEAYAGLTTLADYYEDRNGV
RGSQLPFNFHFITDVNGDSDARDFVYNVEKWLIYMPRGHAANWVMGNHDNPRVASRFGPS
AVDAMNMLLMTLPGVAVTYNGEELGMEDYRDMPWEDTVDPPARNVGEQLFRNVSRDPERT
PFQWNNASHAGFSEASKTWLPVHPNYPELNLEAQKAAPKSHYKVYKALIELRKSAIMRLG
RFTIEPISRWVFAFKRSFANFDSIITVINVSDKEQLVNLSEFLNQPKKLVVEVAGVESAY
QPGQFLAAIALSLAPHEGLVCRLV
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcctggtgaagagcgatgcggaggacttcatagactggtggcaacacacggtg
ttctaccagatctatccgagatccttcaaggacagcaacggcgatggcattggagatcta
ccgggcatcacgtcgaagctgcagtatctcgcggagacgggcatcacggccacctggctg
agccccatcttccagtcgcccatggtggactttggctacgatatatccgactaccggcag
atacagcccgagtacggaaccatggagcactttgagcagctgatagacaaggcctacgag
ctgggcatcaaggtcatactggatttcgtgcccaatcacagttcggatgagcacgagtgg
ttcaagaagtcggcggcaagggagcccggctacgaggactactatgtctgggtggatccg
aagatcgacgagaacggggaccggcagccgcccaacaattggcaatcggtgttctatggg
tctgcctgggagtggcacgagggccggcagcagtactacctgcatcagttcaccaaggag
cagccggacctcaactatcgcaatcccgccgtggtccaggccatggacgatgtgatcctc
ttctggttgaacaagggcgtggccggcttccgcatcgatgcggtgaatcatatgttcgag
aaggagtccctggaggacgagccgctgagtggaaagaccaacgacccgctgtcctacgac
tacaccacacacatctacaccaaggatctgcccgaggtgctcgagatggtccagcactgg
cgccagctgctcgatgacttcagctccaaacatcccgagggccccacgcgcatcatgatg
acggaggcgtatgccggactcacgactctggccgactactatgaggaccggaacggcgtc
cggggctcgcagctgcccttcaacttccacttcatcacggatgtgaatggcgactcggat
gcgcgtgactttgtctacaatgtggagaagtggctgatctacatgccccgtgggcacgcg
gccaactgggtcatgggcaaccacgacaatccccgtgtcgcctcccgtttcggtccgtcc
gccgtggatgccatgaacatgctgctgatgacactccccggcgttgccgtcacctacaat
ggcgaggagctgggcatggaggactatcgtgacatgccctgggaggacacagtggatccg
cctgcccgcaatgtgggagagcagctctttaggaacgtgtccagggatccagagcgtaca
ccattccaatggaacaatgccagccatgcgggcttctccgaggcctccaagacctggctg
ccagtgcatcccaattatccggagctcaatttggaggcccagaaagcagcccccaagagc
cactacaaggtctataaggcgctcatcgagctgaggaaatcggccattatgcggctggga
cgtttcaccatcgagcccatctcccgctgggtgtttgccttcaagagatcgtttgccaac
tttgattcgataattaccgtcatcaatgtgagcgacaaggagcagttggtcaatctctca
gagttcctcaatcagcccaagaaactggtcgtggaagtggctggcgtggagtccgcgtat
cagccgggtcaattcctggccgcaatcgccctgtccctggctccgcacgagggtctcgtc
tgccgactcgtctag

DBGET integrated database retrieval system