KEGG   Drosophila persimilis: Dper_GL17144Help
Entry
Dper_GL17144      CDS       T01063                                 

Definition
(RefSeq) GL17144 gene product from transcript GL17144-RA
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dpe  Drosophila persimilis
Pathway
dpe04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dper_GL17144
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dpe01002]
    Dper_GL17144
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpe04147]
    Dper_GL17144
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dper_GL17144
Peptidases [BR:dpe01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dper_GL17144
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dper_GL17144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 6592574
NCBI-ProteinID: XP_002017739
FlyBase: FBgn0154748
UniProt: B4GGF8
LinkDB All DBs
AA seq 252 aa AA seqDB search
MTATGIVLLLVLLILGVTTANDTKGRIVGGAEQAIHNAPWQVSIQISARHECGGVIYSKD
IIITAGHCLDGKSVTLMKVRVGAEHHNYGGTLVPVAAYKVHEKFDLKYLHYDIAVMRLSA
PLSFGLSIKAINLARVSPSGGTNATVSGWGYTEQDGSYAGNLQTVQLQIIERGQCASTTY
GYGWDYVGEETICAAYAERDACTGDSGGPLVANHLLVGIVSWGYKCALDNYPGVYADVAV
LRPWIVNAANAI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccactgggatagttttgctgctcgtcctcctcattcttggagtaaccacagcc
aacgataccaagggacgcattgtgggcggagccgagcaggccattcacaatgcgccctgg
caggtgtccatacagatcagtgcacgtcacgaatgcggcggcgtcatctacagcaaggat
attattatcacggcggggcactgcttggacgggaaatccgttactctgatgaaggtgcgc
gtgggtgccgaacaccacaactacggcggaactttggtacctgtagcggcctacaaggta
cacgagaagttcgacttgaaatatctccactacgatattgccgtgatgcgtctgtccgca
cctctcagcttcggcctctccataaaggccatcaatttggccagagtaagtccctcaggc
ggaacaaatgccaccgttagcggttggggctacacagagcaggacggtagctacgccggc
aacctccagacggtccagctgcagatcatcgagcgaggacaatgcgcctccaccacttat
ggctacggctgggactatgttggggaggaaacgatctgcgccgcctacgctgaaagggat
gcctgcacgggagactctggtggtccactggtagcgaaccacttgctggtgggcatcgtc
tcctggggatacaagtgtgcgcttgataactacccgggtgtgtatgcagatgtggccgtt
ctaagaccttggatagttaacgcagcaaatgcaatttaa

DBGET integrated database retrieval system