KEGG   Drosophila persimilis: Dper_GL17405Help
Entry
Dper_GL17405      CDS       T01063                                 

Definition
(RefSeq) GL17405 gene product from transcript GL17405-RA
  KO
K02358  elongation factor Tu
Organism
dpe  Drosophila persimilis
Brite
Translation factors [BR:dpe03012]
 Eukaryotic Type
  Elongation factors
   Dper_GL17405
 Prokaryotic Type
   Dper_GL17405
Mitochondrial biogenesis [BR:dpe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dper_GL17405
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dper_GL17405
  Exosomal proteins of breast cancer cells
   Dper_GL17405
  Exosomal proteins of colorectal cancer cells
   Dper_GL17405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-GeneID: 6592755
NCBI-ProteinID: XP_002017872
FlyBase: FBgn0155008
UniProt: B4GGU1
LinkDB All DBs
AA seq 488 aa AA seqDB search
MSHAFAAAVSVCRSAAPMVIRSSRRTMSSSRMLRLACATGPAAVNRDCKRNGLLAGRTGN
VQQYLRQYANEKKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKHLAESKKYNEID
NAPEEKARGITINVAHVEYQTESRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDG
AMPQTREHMLLAKQIGIDHIVVFINKVDAADQEMVDLVEMEIRELLSEMGYDGDNIPVVK
GSALCALEDKNPEIGSEAILKLLKEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVTG
RLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRG
MVMCKPGSVKAMDQLEAQVYILSKEEGGRTKPFMSFIQLQMFSRTWDCAVQVQIPDKDMV
MPGEDTKLILRLIRPMVMEQGQRFTLRDGNLTLGTGVVTKTMSALTETQRSELTEGKKAR
EKKEAAKK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatgcatttgctgctgccgtatccgtatgccggtcggctgcccccatggtcatt
cgtagcagccgccggaccatgagctcatcccggatgctgagattggcttgcgccaccggg
ccggccgctgtcaatcgggattgcaagcggaatggtttactcgctggcaggaccggcaac
gttcagcaataccttcgtcaatacgccaatgagaagaaggtcttcgagcgcaccaagccg
cattgcaatgtgggcaccattggccatgttgatcacggcaagacaactctgaccgcagcc
atcaccaaagtacttgcggacaaacacctggccgagagcaaaaagtacaatgagattgac
aacgcgccggaggagaaggccagaggcattacgatcaatgtggcccatgtcgagtaccag
acagaatcgcgtcattatggtcacacggattgcccaggacatgctgactacatcaagaac
atgatcacgggcacagctcaaatggatggggccattctagtcgtggctgcaacggacggc
gctatgccccagacccgtgagcacatgctgctggccaaacagattggcattgatcatatc
gttgtgtttataaacaaagtggatgccgccgatcaggagatggttgacctagtggaaatg
gaaatacgcgagctgctcagcgagatgggctatgatggggataatattcctgtcgtaaaa
ggctcagctctgtgcgctctggaggataaaaatcccgaaattggttcggaggcgattcta
aagctgctcaaggaagtagacagcttcataccaactccagtgcgtgagctggacaagcct
ttccttctgccagtggagaatgtatactctattccaggacgcggaactgttgtcactggt
cgcttggagcgaggtgtggtcaagaagggaatggaatgtgaatttgtcggctacaacaag
gtgctcaagtcgacggtgactggcgtagagatgttccatcagattttggaggaggctcag
gctggagatcaactgggagccttggtgcgcggcgttaagcgagatgacatcaagcgtggc
atggttatgtgcaagccaggcagtgtaaaggccatggatcagctggaggcacaggtctac
atattgtccaaggaagagggtggtcgcaccaagcccttcatgtcgttcattcaactccaa
atgttctcgcgcacctgggactgtgctgtccaagtgcaaatccccgacaaggacatggtc
atgcctggggaggataccaaactgatactgcgtctcatccgccctatggtcatggaacag
ggacaacgtttcactctacgcgacggaaacctgactctgggcactggtgttgttaccaag
accatgtcggcgctcactgagacgcaacgctccgagctaactgagggcaagaaggcgcgc
gagaagaaggaggctgccaagaagtaa

DBGET integrated database retrieval system