KEGG   Drosophila persimilis: Dper_GL20912Help
Entry
Dper_GL20912      CDS       T01063                                 

Definition
(RefSeq) GL20912 gene product from transcript GL20912-RA
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
dpe  Drosophila persimilis
Pathway
dpe00010  Glycolysis / Gluconeogenesis
dpe00053  Ascorbate and aldarate metabolism
dpe00071  Fatty acid degradation
dpe00260  Glycine, serine and threonine metabolism
dpe00280  Valine, leucine and isoleucine degradation
dpe00310  Lysine degradation
dpe00330  Arginine and proline metabolism
dpe00340  Histidine metabolism
dpe00380  Tryptophan metabolism
dpe00410  beta-Alanine metabolism
dpe00561  Glycerolipid metabolism
dpe00620  Pyruvate metabolism
dpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dper_GL20912
   00053 Ascorbate and aldarate metabolism
    Dper_GL20912
   00620 Pyruvate metabolism
    Dper_GL20912
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dper_GL20912
   00561 Glycerolipid metabolism
    Dper_GL20912
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dper_GL20912
   00280 Valine, leucine and isoleucine degradation
    Dper_GL20912
   00310 Lysine degradation
    Dper_GL20912
   00330 Arginine and proline metabolism
    Dper_GL20912
   00340 Histidine metabolism
    Dper_GL20912
   00380 Tryptophan metabolism
    Dper_GL20912
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dper_GL20912
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Dper_GL20912
    1.2.1.8  betaine-aldehyde dehydrogenase
     Dper_GL20912
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     Dper_GL20912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 6602384
NCBI-ProteinID: XP_002027388
FlyBase: FBgn0158507
UniProt: B4H959
LinkDB All DBs
AA seq 537 aa AA seqDB search
MIAHLRHFSRLAGRGHSRLASSASTSYLIDQPEYGFLKELGLEINNPGVYSGQWQGRGPT
ITSYDPGTGQAIATVRQGTVQELQQAIGLGVEAYKQWRQVPAPVRGEIVRQIGDELRKYK
EPLGKLVSLEVGKIYSEGQGEVQEFIDICDYAVGLSRIYSGQLINSERADHTILEAWRPL
GLVGVISAYNFPNAVFGWNAAIALTTGNSVLWKGAPSTPLVSVATTKIVAEVLRRNNLPP
VVTLCQGGTDVGQSLVSDKRVNLVSFTGSCKTGQDVGVEVQRRFGKVILELGGNNALIID
SSANLKMALDAALFGCIGTSGQRCTTTRRIIVHEQLHDQFVTSLVAKYKHLIPKIGHQLD
GQTLVGPVHTQQNVDSYKTAIEEAKALGGTVAFGGKVLERSGYYVEPTVITGLPHDASVV
HRETFAPIVYVLKAKSVDEAISWNNEVEQGLSSAIFTENISQAFKWIGARGSDCGIVNIN
TTTNGAEIGGAFGGEKATGGGRESGSDAWKQYCKRATITVNHSGELACAQGVVFNVE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcacatttgagacacttttcgaggctggccggtcgcggacacagccgcctggcc
tcctccgcatccacatcctatctgatcgaccagccggagtacggtttccttaaggagctt
ggcctggagatcaacaatcccggcgtctactcgggccagtggcaggggcgtggcccgacc
atcaccagctacgatcctggcaccggccaagccattgccacagtgcgtcagggaactgtg
caggagctgcaacaggccatcggcctgggcgtggaggcctacaagcagtggcgccaggtc
cccgccccagtccgtggcgagatcgttcggcaaatcggcgacgagctgaggaagtacaaa
gagccccttggaaagctggtctccctggaggtgggcaagatctacagcgagggtcagggc
gaggtgcaggaattcatcgacatctgcgactatgccgtgggtctgtcgcggatctactcg
ggccaactgatcaactcggagcgggccgaccatacgattcttgaggcttggcgaccgctt
ggactggtcggtgtgatctccgcctacaatttccccaatgccgtatttggctggaatgcc
gccattgctctgaccaccggcaacagtgtgctctggaagggagctcccagcacgcccctg
gtctcggtggccaccaccaaaatcgttgccgaagttctgcgtcgcaacaatctgccaccc
gtcgtgaccctctgccagggaggaaccgatgttggccaatcgttggtgtctgacaagcgc
gtcaatctggtttcctttacgggtagctgcaaaacgggccaagatgtgggcgtggaggtg
cagcggcgcttcggcaaggtgatcctcgagctgggcggcaacaatgctttgatcatcgat
tcgtcggcaaatttgaaaatggcattggatgcagctctctttggctgcatcggcaccagc
ggacaacgctgcaccaccaccaggcgcatcattgtccacgaacaactgcatgaccagttt
gtcacgtccttggtggccaagtacaagcatctgatacccaaaattggacaccaattggat
gggcagacgttggtgggccccgtgcacacccagcagaacgtcgatagctataagaccgcc
attgaggaggccaaggccttgggcggaactgtggcttttggcggcaaagtcctggagcga
tcgggatactatgtggagcccactgtcatcacgggtctgccgcacgatgccagcgttgtg
catcgcgaaacgtttgcccccatcgtgtatgtcctgaaagcgaagagtgtggacgaggcc
atctcctggaacaacgaagtcgagcagggtctctcgtcggccatttttaccgagaacatc
agtcaggcgttcaagtggatcggtgccaggggctccgactgcggcatcgtaaacataaac
accaccacaaatggagctgaaatcggtggagcgttcggtggagagaaggccaccggcgga
ggtcgagagtcgggctcggatgcctggaagcagtactgtaagcgggcaacaatcacggtc
aaccattccggggaactggcctgcgcccagggcgtcgttttcaatgtggagtag

DBGET integrated database retrieval system