KEGG   Drosophila persimilis: Dper_GL24434Help
Entry
Dper_GL24434      CDS       T01063                                 

Definition
(RefSeq) GL24434 gene product from transcript GL24434-RA
  KO
K01360  proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     Dper_GL24434
Peptidases [BR:dpe01002]
 Serine Peptidases
  Family S8: subtilisin family
   Dper_GL24434
Chaperones and folding catalysts [BR:dpe03110]
 Intramolecular chaperones
  Subtilisin family
   Dper_GL24434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain
Motif
Other DBs
NCBI-GeneID: 6588537
NCBI-ProteinID: XP_002013973
FlyBase: FBgn0162023
UniProt: B4G387
LinkDB All DBs
AA seq 662 aa AA seqDB search
MFIAAAAWSCTAASWRLLSAGLLALSLLQLAVETGAGSSGGLGNQAVFTSSFLVRFRRNV
DNDFAHQVADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPSVHTAV
QQPGFKRVKRGLRPAVPAIHGMKFDLKQGEANRIEEEPTDPYFPMQWYLKNTGQNGGKVR
LDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDD
WFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIH
IYSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYA
ASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTS
AAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLF
GFGVLDAGAMVTLSKQWHAVPPRYHCEAGAITQSQAIIMGRSLFWDIKTDACKGTDTEVN
YLEHVQAVISANSSRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGE
YPQGTWKLEARFNSPQTRHGNLLEWSLVLHGTKEAPYRTLHPSSPHSKLAIVKKAHEDKK
MK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgttcattgcagcagccgcctggagctgcactgctgcttcatggcgcctgctgagcgcc
gggctgctagccctctccctgctccaactggccgttgagacgggtgccggatcgagcggc
ggattgggcaatcaggccgtgttcactagctcgttcctggtgcgcttccggcgcaacgtt
gacaatgacttcgcccaccaggtggccgacaaatatggcttcgacaatctggggccgctg
gtcggcgccgacggacacgagtatcatttcaagcaccggaccctgccgcatgcccgctcc
agacgcagtttgacgcacacgcgtgccctcaagagccatccctcggtacacacggctgtg
caacaacccggattcaagcgcgtcaagcggggactgcgaccggcagtgcctgccattcat
ggcatgaaattcgatttgaagcagggggaggccaaccgcatcgaggaggagcccacggac
ccctacttccccatgcaatggtacctgaagaacaccggccagaacgggggcaaggtgcga
ctcgacctgaatgtgcaggcggcctgggcccagggcataaccggaaagaatgtgaccacg
gcaatcatggatgatggcgtggactacatgcatccggacctgaaatttaattataatgcc
gaggccagctatgacttcagcagcaatgatccctttccctacccacgttacactgacgac
tggtttaacagtcatggaacccgttgtgccggcgaggtggctgctgccagagataatgga
atttgcggtgtcggcgttgcttatgacagcaaaatcgcaggcatacgcatgctggatcag
ccgtatatgacggatctaatcgaggccaactccatgggccatgagccgcacaaaatccac
atctacagcgcctcctggggccccacggacgatggcaaaacggtcgacggtccccggaat
gccaccatgagggcgattgtccagggcgtcaatgagggtcgaaatggtctgggcaacatc
tatgtctgggcatcgggcgatggcggcgaggaggacgactgcaactgtgatggctatgcc
gcctccatgtggacgatttccattaacagcgccattaacgacggccagaacgctcactac
gacgagagctgcagctccacgctggcatccacgttcagcaacggtgccaaggaccccaac
acgggcgttgccaccactgacctgtacggcaagtgtacgaccactcactcgggcaccagt
gcggcggcgcccgaagcagcgggcgtctttgctttggccttggaggcaaacccacaactc
acttggcgcgacatccagcatctgacggtactgacatcgaagcgcaactctctgttcgat
gccaagaaccgcttccactggacaatgaacggcgtgggcctggagttcaaccacctcttc
gggttcggcgtgctcgatgctggtgccatggtgacgctctccaagcaatggcatgcagtg
ccaccgcgctaccattgcgaggcgggcgcgataacccaatcgcaggcaattatcatgggt
cgctcactgttctgggacattaagaccgatgcctgcaagggcactgacacggaggtcaac
tacttggagcacgttcaggctgtgatctcggcgaattcttcgcgacgcggcgacctggaa
ctcttccttacatcccccatgggcaccaaatcaatgatcctgtcgcgtcgcgccaatgat
gatgaccatcgcgatggcttcaccaagtggcccttcatgaccactcattcctggggcgag
tatccgcagggaacctggaagctagaggcacgtttcaattcccctcaaacccgacatggt
aatctgctggaatggtctctcgtgctgcatggcaccaaggaggcgccctatcgcactctg
cacccatcctcgccgcactcgaagctggccatcgtgaagaaggcccacgaggacaagaag
atgaagtag

DBGET integrated database retrieval system