KEGG   Pseudodesulfovibrio piezophilus: BN4_20319Help
Entry
BN4_20319         CDS       T02481                                 

Definition
(GenBank) PAS/PAC sensor hybrid histidine kinase
Organism
dpi  Pseudodesulfovibrio piezophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg ABC_sub_bind PAS_4 HisKA PAS_9 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: CCH50381
UniProt: M1WKY0
LinkDB All DBs
Position
3433914..3436598
Genome map
AA seq 894 aa AA seqDB search
MESRIITRDSEKEVGMPMKIMIKFCLFLVLTCLVPNGAQAEKAKKNVLYLNSYHDGYQWS
DSIMDGVRSILDESEFKINLQVEYMDFKRYEHDAVSGMLLRLYKEKFAHEAFDVVMAVDD
DAFMFASEFRNELFPGVPLVFCGVNDLKDGALKQGNVTGLVENFNLMQTLDVALKLHPDK
RRMIVVGDTSTAGLAIKQQVEHGVEKYQPHLEVEYWTRLTLAEVLERVKVLPSDTFLFFI
PYYQTIGGRFYTAEDVMAAIYRHSAVPIYTAWEFLLGNGAVGGRMLSGFKHGQQAASVAL
RILKGESADSIPVFKEPTGEYVFDYQVLWRLGITEELLPPNSRLINAPSPFYELPKELFW
TIIVSFVLLLVVMAFLVTTMTERRKVERKIKDQLAFQETLMDAVPQLVSWKDRQGIYLGT
NRAFAEFFGGEGSGNGVNWLAKNDTRDPEHVAWATGADLTVLSQGVGLRKVRRKLMDANG
NHAWLEINKVPIHDQAGAIVGVLSTAENITKERNLEKQLLQSQKMEAIGTLAGGIAHDFN
NILTSIINSTELAVGDVDSDSVTSKDLQRVLKAARRGGRVVKQILAFSRPSTEGFRSTDV
GSVVSEVLGLLEASMPSNIRVRSSIAPMLDFVRADPTQLHQVAMNLCTNSFHALRGKGGI
IEVRVDQAVLAKEDARILGLAPGEYVRMSIEDNGPGIPPEIIDKIFDPFFSTKDKTEGTG
LGLSVVHGIIRSHGGGLQVTGRTGGGTVFEIYLPKVDKSDVELPSSGTFTIPGWAHVLFV
EDDYDQLHTTPRLLRTMGYEVTAIRDPEEAIVRVKGMPHIFDLLITDYDMPGMSGTQLAI
EVAHHVPNMPIILVSGREDAATAAAHLPNIRQVVIKPYDKDDLSEAISAVMNSK
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgcgtatcatcactcgtgacagcgagaaggaagtcggaatgcccatgaaaata
atgatcaaattttgtctttttctggttttgacctgtttggtacccaatggggcacaagcg
gaaaaagccaaaaagaatgttctctacctcaattcatatcatgacggatatcagtggtct
gactccattatggatggggttcgatcaattcttgatgagagcgaattcaaaataaatctt
caagtcgaatatatggatttcaagcggtatgagcatgatgccgtttctggaatgcttctt
cggctctacaaggaaaaattcgcgcatgaagccttcgatgtcgtgatggccgtggatgac
gatgccttcatgtttgcaagtgaatttcgaaatgaattgtttccgggtgtcccgctggtc
ttctgcggtgtgaacgatttgaaggacggagcgcttaagcaaggcaacgtgactggtctc
gtggagaatttcaacctgatgcagactttggatgtcgccctcaagttgcatccggataag
agacggatgattgtcgtgggagatacttccaccgccggattggctatcaagcagcaggtt
gagcatggtgtcgagaagtaccagccgcatcttgaagttgaatactggactcgactgacg
ctggctgaagtgcttgaacgggtcaaggtgctgccatcggataccttcttgtttttcatc
ccgtactatcagaccattggcgggcgcttttacactgctgaagatgtcatggccgccatt
tataggcattccgctgttcctatttacacggcatgggagttcctgctgggtaatggtgca
gtggggggaaggatgttgtcgggcttcaagcatgggcaacaggctgcatctgtcgccctt
cggattctcaaaggggaatccgcagacagcatccctgtctttaaggagccgacaggtgaa
tatgtcttcgattatcaagtcttatggcggttgggtatcacagaagagcttttacctcct
aacagccgtctgatcaacgcaccgagtccattttatgagttgcccaaggaactcttctgg
accattatcgtgagttttgtgctgctcttggttgtcatggcatttttggtcacgaccatg
actgaacggcgtaaggttgaaagaaaaatcaaggaccagttggcttttcaggaaacattg
atggacgctgtccctcagcttgtttcatggaaggatcgtcaaggaatatatctcggaacc
aatcgggcctttgcagaattcttcggtggtgaaggaagcggtaatggggtgaattggctg
gccaaaaatgacacacgtgatcctgagcatgttgcctgggcaaccggggcagacttgact
gtgttgagtcaaggggtagggctcaggaaagttcgacgcaaactcatggatgccaatggc
aatcatgcgtggcttgagatcaacaaggtgcccattcatgatcaggccggagcgatcgtc
ggtgtattgagcacggccgagaatattaccaaggagcgcaatctcgaaaaacagcttctg
caatcacaaaagatggaagctattggaactctggccggaggaattgcacatgatttcaat
aacatattgacatcaattatcaactctacagagctggccgtgggagatgttgattcggat
tcagtgaccagtaaagatttgcaacgggtgctgaaggccgcgcggcgtggtggccgggtg
gtgaagcagattctcgcttttagtcggccttccaccgagggattccgctcaacggatgtc
gggagtgttgtttcagaagtcctcggtcttctcgaggcctccatgcccagtaatattcgg
gtacgttcaagtatcgctcccatgcttgactttgtccgtgcagacccgactcagttgcac
caggtggccatgaatctctgcacgaattcatttcatgctctgcgagggaagggcggtatt
atcgaagtccgcgtggaccaggctgttctcgccaaggaagatgcccgtatcctggggctg
gctcccggtgaatatgttcgtatgagtattgaggacaacggacctggtattcctcctgaa
attattgataagatatttgatccgtttttttctactaaggataagaccgaaggcaccggg
ttggggctttccgtagtgcatggtattatacgcagtcacggaggagggcttcaggttacc
ggcaggaccggcggcggcactgtttttgaaatttatttgcccaaagtggacaaaagtgac
gttgaattacccagcagcggtacattcacgattccgggatgggcgcacgtccttttcgtg
gaagacgattatgatcaattgcacaccacgccgcgtctgctcaggaccatggggtatgaa
gtgacagcgattcgagacccggaagaggccattgtccgtgtcaagggaatgccacatata
ttcgacctgcttatcactgattatgacatgcctggcatgagcgggactcaattggcaata
gaagttgctcatcatgtccccaatatgccgattatcctggtttccggtcgtgaagatgct
gcgactgccgctgcccacttgcccaatatccgtcaggtggttatcaaaccatatgacaag
gatgacctgtcagaagcgatttcggcggtcatgaattcgaaataa

DBGET integrated database retrieval system