KEGG   Danaus plexippus (monarch butterfly): KGM_200427Help
Entry
KGM_200427        CDS       T04344                                 

Definition
(GenBank) Succinate dehydrogenase [ubiquinone] flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00020  Citrate cycle (TCA cycle)
dpl00190  Oxidative phosphorylation
dpl01100  Metabolic pathways
dpl01200  Carbon metabolism
Module
dpl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KGM_200427
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KGM_200427
Enzymes [BR:dpl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KGM_200427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: OWR52136
UniProt: A0A212FEF5
LinkDB All DBs
Position
Unknown
AA seq 655 aa AA seqDB search
MSALIKAAVSRSPSCLATYLNRNLHLTVGASASKDASVNSNASKSYTVIDHKHDALVIGA
GGAGLRAAFGLVQEGFKTAVVTKLFPTRSHTVAAQGGINAALGNMEEDNWLWHMYDTVKG
SDWLGDQDAIHYMTKEAPHAVIELDNYGMPFSRTPEGRIYQRAFGGQSLKFGKGGQAHRC
CAVADRTGHSLLHTLYGQSLRYDCEYFIEYFALDLLMEDGVCKGCIAINLEDGTLHRFQA
KNTILATGGTGRSYFSCTSAHTCTGDGTAMAARAGLQNEDMEFVQFHPTGIYGAGCLMTE
GCRGEGGFLVNAKGERFMERYAPVAKDLASRDVVSRAMTVEIMEGRGCGPEKDHVHLQLH
HLPPEQLKQRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGTPTNFRGEVITHYNGED
RVVPGLLAAGEASCASVHGANRLGANSLLDIVVFGRACALTVADTSRPGDKQEPLKDTTG
QESIGNLDKLRYANGSISTAELRLRMQKCMQKNAAVFRQKSTLEEGQRQIHEVYKQMADV
KVSDRSLIWNSDLVETLELQNLLINAVQIVEGALAREESRGAHAREDFKTRRDEYDYSKP
LEGQTKLPFEKHWRKHTLSETNAATGETKLSYRPVIDHTLDQAECQTVPPVIRTY
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcattgattaaggccgcagtttcccgcagcccgtcatgtttggcgacatattta
aacaggaacctccacctaacagtgggagcgtcagcatcgaaagacgcttctgtgaattcg
aacgcaagtaaatcgtacacggttatcgatcacaagcacgatgccttagttattggggct
ggaggagctggtttaagagccgcctttggtttggtacaggagggattcaaaactgctgtt
gtaacaaagctattccctaccagatcccatactgttgctgcacagggaggcatcaatgct
gcattaggtaatatggaagaagataattggttgtggcacatgtatgatactgtcaaggga
tctgactggctcggagaccaggacgccatccattacatgacgaaggaagcacctcatgct
gttattgagttagacaactatggcatgcctttttcgcgcacaccagaaggtagaatatac
cagagggccttcggtggtcagtcactcaagtttggtaaagggggtcaagctcatagatgc
tgcgctgtagccgacagaacgggccattcacttctccatacactctacggccaatccctc
cgatatgactgtgaatacttcattgagtattttgctctggatctcctgatggaagacgga
gtctgcaagggatgtatcgctattaaccttgaggacggaactttacataggttccaagct
aagaacactatcctcgccacgggtggcactgggcggtcgtacttcagctgcacctcggct
cacacgtgcactggggacggaacagccatggcggctcgagctggtctccagaacgaggac
atggagtttgtgcagttccaccccaccggtatctacggagctggttgtctaatgaccgaa
ggttgtcgtggtgaaggcggtttccttgtgaacgctaagggcgagcggttcatggaaaga
tatgcaccggtcgccaaagacctcgccagcagggacgtggtctccagagccatgaccgtg
gagatcatggaaggtcgcggctgcggtccagaaaaggaccacgtccaccttcagctgcac
catctgcctccggaacagctgaagcagcgtctccccggcatctcggagacggccatgatc
ttcgccggagtcgacgtcaccaaggaacccatacctgtgttgcccaccgtacactacaac
atgggcggaacgccgaccaacttcaggggagaggttataacgcattacaacggcgaagac
cgcgtggtccctggtctactggcagctggtgaggcttcctgtgcctccgtccatggtgca
aacagattgggggcgaactccctccttgatatcgttgtgtttggaagagcctgcgccctc
acagtcgcagacaccagccgccctggggacaagcaggagccgctcaaagacaccactggt
caggaaagtatcggtaatctggacaagttaaggtacgcgaacggcagcatctccaccgcg
gagctgcgcctgcgcatgcagaaatgtatgcagaagaacgcggccgtgttcagacagaag
agcacactagaagaaggtcaacgccagatccacgaggtgtacaagcagatggcggacgtg
aaggtttcagatcgctcactgatctggaacagcgacctggtggagaccctggagctgcag
aacctgctcatcaacgcggtccagatcgtggagggcgcgctggccagggaggagtcccga
ggagcgcacgcccgggaggacttcaagaccaggagggacgagtacgactactccaagcca
ctcgagggacagacaaaattgccgttcgagaagcactggcgcaagcatacattgtcggag
accaacgcggccaccggcgagaccaaactcagctacagaccggtcatagaccacacgctc
gaccaggccgagtgccagaccgtgccgcccgtcatacgcacatactag

DBGET integrated database retrieval system