KEGG   Danaus plexippus (monarch butterfly): KGM_201001Help
Entry
KGM_201001        CDS       T04344                                 

Definition
(GenBank) Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00562  Inositol phosphate metabolism
dpl01100  Metabolic pathways
dpl04068  FoxO signaling pathway
dpl04070  Phosphatidylinositol signaling system
dpl04140  Autophagy - animal
dpl04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    KGM_201001
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    KGM_201001
   04070 Phosphatidylinositol signaling system
    KGM_201001
   04150 mTOR signaling pathway
    KGM_201001
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    KGM_201001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpl01009]
    KGM_201001
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     KGM_201001
    3.1.3.48  protein-tyrosine-phosphatase
     KGM_201001
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     KGM_201001
Protein phosphatases and associated proteins [BR:dpl01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    KGM_201001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase DSPn PTPlike_phytase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-ProteinID: OWR43665
UniProt: A0A212EQA5
LinkDB All DBs
Position
Unknown
AA seq 573 aa AA seqDB search
MGFPAEKLEGVYRNHIDEVYRFLEQKHKDHYMIYNLCAEREYDYTKFNKRVQVFAFKDHE
PPKIGQIQPFCEDVHNWLSKDPRNVAAVHCKAGKGRTGTMVCCYLLYSGQKTTADEALKY
YGNKRTHDEKGVTIPSQRRYVEYYAALVRGGLSYRATRVHVRELLMYPPPAFNGSQCTLQ
LTVTQADPFHKTSLGSHEVRRHESVARVVATACAPLAGDVRVDVYCKPKMKMRKERLFHF
WFNTYFVTAGVGAANVPAPIDSQNQETFKLTLDKWQLDDAHKDKQHKMYSADFKVELIVH
KLPESSTFSVPRGSSPASSSSDPDTEHEQEWDSGETDYTTDKYLQTDPEIDPEIDRGISD
AADSDRQLHTSHQYHRQRECDALPGSNPFYPRSDPFAPSDLPPRLRPGPDPQHSPPYRYL
SNVPEYPEHFPRDCTRVDRPPPTHTTHPPETNTNGDEDLLYTDTEPVMFGGHKLADYRLE
KLPEYTHSGYYDDRNNFNVPMARYDVCPGDEYPAGEDADTMEYRGDDAKQYDRNKKCKDP
LTKPRLSLGDMRASWREFSGKFGENRKKKNRDD
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgggcttccccgccgagaagctggagggtgtgtacaggaaccacatagatgaagtgtac
cgcttcctggaacagaagcacaaggaccactacatgatatacaacctgtgcgccgagaga
gagtacgactacaccaagttcaacaagagggtgcaagtgttcgcgttcaaggaccacgag
ccgccgaagatcggtcagatccagccgttctgtgaggacgttcacaactggctcagcaag
gaccctcggaacgtggccgccgtgcactgcaaggctggcaaaggaagaaccggtacaatg
gtgtgctgctacctgctgtacagcggacagaagaccacggcggatgaggctcttaaatac
tatgggaacaaacgcacacacgacgagaaaggtgttacgatcccgtcccagcgacgctac
gtggagtactacgcggcgctggtccgaggagggctctcgtaccgcgccaccagggtgcac
gtccgggagctcctcatgtaccctccgccggccttcaacggctcgcagtgtaccctgcag
ctgacggtcacgcaggctgaccccttccacaagacgtcgctgggcagccacgaggtgcgc
cgccacgagtcggtggcgcgggtggtggcgacggcgtgcgctccgctggccggggacgtg
cgggtggacgtgtactgcaagcccaagatgaagatgaggaaggagaggctgttccacttc
tggttcaacacgtacttcgtcaccgctggcgtcggagccgccaacgtgcccgcgcccatc
gacagtcaaaatcaagaaacattcaagttgacgctggacaagtggcagctggacgacgcg
cacaaagacaagcaacacaaaatgtacagcgccgactttaaggtggagctgatagttcac
aagctgcccgagtcgtcgacgttcagcgttccccgcgggtcctctccggccagctcctcc
tcggacccggacacggaacacgagcaggagtgggactccggtgagacagactacactacg
gacaaatatctccagacagatcccgagatagatcccgagatagaccgcgggatatccgac
gcggccgactccgacaggcagcttcacaccagtcaccagtaccatcgccagcgggaatgc
gacgctctaccggggtcgaacccgttctatccccggagcgatccgttcgctccctccgac
ctccctccccggttacgtcccgggcccgacccgcagcactcccctccctaccgctatctg
tcaaacgtgcccgaatatcccgaacacttccctcgagactgtacgagggtggatcgcccg
cccccgacacacaccacccaccctcccgagacgaacaccaacggtgacgaggacctcctg
tacaccgacaccgagccggtcatgttcggcggacacaaactagcagactatcgcttagag
aaattgccggagtacactcacagtggctactacgacgacagaaataacttcaacgtaccg
atggcgcggtacgacgtgtgtcccggggacgagtacccggcgggggaggacgccgacact
atggagtaccgcggggacgacgccaaacaatacgataggaataagaagtgcaaggaccct
ctcaccaagccgcgtctgtcgctgggggacatgagggcctcgtggagagagttcagcggc
aagttcggcgagaacaggaaaaagaagaatagggacgactga

DBGET integrated database retrieval system