KEGG   Danaus plexippus (monarch butterfly): KGM_201301Help
Entry
KGM_201301        CDS       T04344                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase isoform 1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KGM_201301
Enzymes [BR:dpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KGM_201301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 FAD_binding_2 EF-hand_1 Pyr_redox_2 EF-hand_6 EF-hand_8 FAD_binding_3 EF-hand_5 FAD_oxidored EF-hand_9 HI0933_like NAD_binding_8 GIDA Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-ProteinID: OWR48372
UniProt: A0A212F3S6
LinkDB All DBs
Position
Unknown
AA seq 753 aa AA seqDB search
MSRRKLVVCGAGAAGAVVAAWALSADDRLGSWYKSTTVAAKSERRKRPLPSRTDQIKNLQ
AGHTYDVLIIGGGATGAGCALDATTRGLRTALVEADDFASGTSSRSTKLIHGGVRYLQKA
IMQLDYEQYKMVKEALHERANMLEVAPHLTRPLPILLPVYKWWQVPYYWFGIKMYDLVAG
DRNLKSSYYLSKKNTLELFPMLKSDNLCGGIVYYDGQQDDARMNLAIALTAARHGATITN
HVSVVKLHKTDGKLSGARVRDELTGKEWDVKAKSIINATGPFTDSIRKMDDQTIKDICCP
SSGVHIVLPGYYSPEHMGLLDPATSDGRVIFFLPWLKGTIAGTTDMPCQVTHNPKPTEDE
ILFILTEVKNYLNPDVEVRRGDVLSAWSGIRPLVSDPNKPDTQSLARNHIVHVSPSGLVT
IAGGKWTTYRAMAAEAVDAAIESCNLKPLYKECQTDGFLIEGAHGWTPTMYIRLVQDFGL
EMEVAQHLAKSYGDRAFAVAKMAAMTGKRWPIIGKKIHPEFPYIDAEIRYGVREYACTAV
DMIARRLRLAFLNVQAAAEALPAVIEIMAEELKWNEAERQKQTKIAADFLANEMGQMVNR
ASRDKIPINLNKEEIQTYIKRFQIIDKDRKGFVSINDIRRSLKSMGVKPSDDEISAILSE
IDVTYHGQLEIQDYLQNYGEDVTGEQLHEILREIDTNMNGQVELDEYLQMMSAIKSGHVA
YSRFARMAELEEEHHEKETLKKKITVERSGGGL
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggaggaagctggtggtgtgtggtgctggggcagccggcgccgtggtcgcggcg
tgggccctctcagcagacgacaggctcggatcgtggtacaaatcgacaactgttgcagct
aagtctgagcgcaggaaacgtcccctaccttcccgtacggaccagatcaaaaaccttcag
gcgggacacacttatgatgtcctcattataggtggcggcgccactggagctggctgtgcg
ctcgacgctaccaccagaggtcttcgcacagctttggtcgaagctgacgacttcgcgagc
ggtacatcgagtcggtcaacgaaactcattcacggcggcgtgcgctatttgcagaaagcc
atcatgcagctcgactacgaacagtacaaaatggtgaaggaagctttacacgaacgcgcc
aacatgctggaggtcgcgcctcatttgacaagaccgttaccgatattgttgccagtctac
aaatggtggcaagtgccttactactggtttggtatcaagatgtacgacttggtggctggt
gacagaaatttgaaaagctcatactatctatccaaaaagaacactctagaattattccct
atgttgaaatccgataacttatgtggtggcatagtatactatgatgggcagcaggatgac
gctcgtatgaacctggctatcgctctgaccgcggctcgtcatggagcgaccatcaccaat
cacgtctctgttgtcaaattgcacaagaccgacggcaagctcagcggcgctagagtccga
gacgaactgacaggcaaggaatgggatgtaaaagccaagtccataataaacgcaacaggt
cccttcacggactccatcaggaaaatggacgatcaaactattaaagatatctgctgtccg
tcatctggcgtgcatatcgtgctgcctggatactacagtccagaacacatgggtcttctg
gatccagctacctctgatggtcgcgtcattttcttcctgccgtggttgaagggaaccatc
gccggtacaacggacatgccttgccaggtcactcacaacccaaaaccaaccgaagatgaa
atcctcttcatcctcaccgaagtcaagaactatctcaacccggatgttgaagttcgtcgt
ggggacgttttgtccgcgtggtctggtatccggcccctggtgtcggatcccaacaagccg
gacacgcagtccctcgctcgcaaccacatagtccacgtgtcgccctccggccttgtcact
atcgcggggggcaagtggaccacctaccgcgccatggcagctgaggcggtagacgcggcc
attgaaagctgcaatctaaagccactttacaaggaatgtcaaaccgatggattccttatt
gaaggtgctcacggttggactcccacgatgtacatcagattggtgcaagactttggactg
gaaatggaggtcgcacaacatctggccaagtcgtacggagatagagcattcgctgtggcg
aaaatggcggctatgaccggcaagagatggcccattatcggtaaaaagatccatcccgag
ttcccttacatcgacgccgaaatcaggtacggcgtccgcgagtacgcgtgtacagcggtg
gacatgatcgctcggaggctgcggttggcgttcctcaacgtgcaggcggcggccgaggcg
ctccccgccgtcatagaaatcatggccgaggaactcaagtggaacgaggccgaaagacag
aaacaaactaaaatagcggcggatttcctcgccaatgagatgggacagatggtgaatcgc
gcgagtcgtgacaagataccgatcaatctgaacaaggaagagattcagacgtacatcaag
cggttccagatcatcgacaaggacaggaagggcttcgtctccatcaatgacatcaggagg
agtctcaagagtatgggcgtgaaaccgagtgacgacgagataagtgcgattttatcagaa
attgatgtcacttatcacggacagctggaaattcaggactaccttcagaactacggtgag
gatgtgaccggggaacagttgcacgaaatattgagagaaatcgacactaacatgaatgga
caagtcgaactcgatgaatatttacagatgatgtcagctatcaagtcaggacatgtagct
tactcaagatttgctcgaatggctgaactggaagaggaacaccatgaaaaggaaactctt
aagaagaagatcactgttgaaaggagcgggggagggttgtaa

DBGET integrated database retrieval system