KEGG   Danaus plexippus (monarch butterfly): KGM_201894Help
Entry
KGM_201894        CDS       T04344                                 

Definition
(GenBank) Maltase 1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00052  Galactose metabolism
dpl00500  Starch and sucrose metabolism
dpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KGM_201894
   00500 Starch and sucrose metabolism
    KGM_201894
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     KGM_201894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: OWR49829
UniProt: A0A212F7Y9
LinkDB All DBs
Position
Unknown
AA seq 538 aa AA seqDB search
MLVVALVFFSLGASLADPWWSKAIYYRLLVDSFKDLDGNGLGDLEGATKQLSYVRAIGAD
AVILSPISEKSLDCNSPGTIDFVNIETRYGTIDNFNALLAKANKLELKVLITLQLQTISS
NSILFNSSAERKTGFEDGIVWISGAAEEAPASRAFRNWTWHEYRGAYYATVNKEAILNIC
SESVVAMLSEAMCEWLKRGAAGVLLNPDFLMNYECGQKLVKRIAKEAVACSGNQHYDLPV
ILVESSLEAEVATKYYAEGGVGANSVISYAFSTKAKRPAVGLALDLHAALLYSPQDTTPA
WLTSTSDGNRIATRYGSEMVDAIILLTLILPGSVIIQQGDELGVADTILDWTNTTNCWPM
NYIPSAAPFPWDNSPKANFTTGEPWMPLPPNYRYKNAKSEYGNELSHVSVMKIASAMRKS
AAIGPHVEIKVLKDALAILRWGGGGSLLVVSNLGTGSTEAQLSEIPGLPAEMTVASSSGG
SSLSLGNHITVGKTLKLSHGETVLLVGPPRHCGGPGPVDKITSKLSEGWQKINKYFNL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttggtggtagcgttagttttcttttcactgggagcctcgctcgccgacccctggtgg
agcaaggctatctactacagattactagtggactcatttaaggacctcgacggaaacggc
cttggagatttagaaggagctacaaaacagctaagttacgtacgcgctatcggagctgat
gctgtaatcttatctcccatctccgagaaaagcttggactgtaattcacccgggaccatc
gattttgttaacattgaaacaagatatggtactatcgataactttaatgcactgctggct
aaagcaaataaattagagctcaaagttttgataacattacaactacaaactataagttca
aactcaattttatttaattcaagcgccgaaagaaagactggctttgaagatggaattgta
tggatcagtggagcagctgaggaagcaccggccagtcgagcgtttagaaactggacgtgg
catgaatacagaggagcttattatgcaactgttaacaaagaggcgatattaaatatttgc
tctgaaagtgtcgttgcgatgctatctgaagctatgtgcgagtggttgaagaggggagcc
gctggagttctgcttaatcctgactttttaatgaattacgaatgtggtcaaaaacttgtc
aaaaggatagcgaaagaggccgtggcctgctcggggaatcaacattatgatctgccggtt
attttagtagaatcctctctggaggcggaagtcgctactaaatattacgctgagggcggt
gtaggtgccaatagcgtaataagttatgccttttctacaaaagccaaacggccggctgtt
ggcttggcgctcgacctgcacgcagcgctgttgtattcaccacaagatacgacccccgct
tggctcaccagcacatccgacggaaaccggatagcaactcgttatggcagcgaaatggtt
gatgctataatactattaactttgattcttcctggctctgttatcattcaacaaggagat
gagctaggagttgcagacaccatacttgattggacaaatactaccaattgttggccaatg
aattacataccttcggctgctccttttccatgggataatagccctaaagctaattttact
acgggagaaccctggatgccgctgcctccaaattacaggtataagaacgcaaaatctgaa
tatggtaatgaattgagccatgttagtgtaatgaagatagcatctgcaatgagaaaatct
gcagctattgggccacacgttgagataaaagtattaaaagatgcgctagcgatattgcgg
tggggtgggggcggatcacttttagtcgtatctaatcttggtaccgggtcgactgaggct
cagctttccgagattcctggactaccagctgaaatgacggtagcatcaagttctggagga
tctagtttatctctcggcaaccatatcacagtaggaaagacgttaaaattgtcgcatggg
gaaaccgtgctcctggttggacctccgagacactgtgggggaccgggaccagtggataaa
attacgagcaaactctctgagggatggcagaaaatcaacaagtacttcaacctctga

DBGET integrated database retrieval system