KEGG   Danaus plexippus (monarch butterfly): KGM_205661
Entry
KGM_205661        CDS       T04344                                 

Definition
(GenBank) hypothetical protein
  KO
K16679  wengen
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl04013  MAPK signaling pathway - fly
dpl04214  Apoptosis - fly
dpl04215  Apoptosis - multiple species
dpl04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    KGM_205661
   04391 Hippo signaling pathway - fly
    KGM_205661
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    KGM_205661
   04215 Apoptosis - multiple species
    KGM_205661
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-ProteinID: OWR55450
UniProt: A0A212FP26
LinkDB
Position
Unknown
AA seq 204 aa
MILSIEVMRVLSLWLLALMLPVALGVCERGRTWWHRQKGLCLPCTRCDPRRLAVRYPCEP
HRDTICQPLYEVRIWPFSTDNDTDYEYYDYSDVTGDYSDVSDDTWDIQTSTLTLAVSGCV
VFFAVVLTLSLYHAKQWRVLKQALKSDVQDLSAKLKLVEAGESPGEPIPAGHIYCNIHVA
KEALMGTATKNCLGNVYTQEKHTP
NT seq 615 nt   +upstreamnt  +downstreamnt
atgattctgagcattgaggtgatgcgagttttatccctgtggctgctcgcgttaatgttg
cccgtagcgctgggcgtctgcgagcgtggtcgaacatggtggcatcgtcagaaaggtctc
tgcctgccgtgtacccgctgcgaccctcgtcgcctcgccgtccgatatccctgtgaaccg
cacagggacactatctgccagcctctatatgaagtccgcatatggcctttcagtacagac
aatgacacggattacgagtattacgattacagtgacgtgactggtgattacagtgatgtg
agtgatgacacgtgggatattcaaacttcgacgttgacgttggctgttagtggttgtgtt
gtgttctttgctgttgtcctgacgttatcgctgtatcacgcgaagcagtggcgcgtgctc
aaacaggctctcaagtcagacgtacaagatctatcagccaagctgaagcttgtggaggct
ggcgagtctcccggtgagcccataccagccggacacatctactgcaacatacacgtcgcc
aaagaagctttaatgggcactgcgacgaagaattgtttggggaacgtctacacacaagaa
aaacacacaccatga

DBGET integrated database retrieval system