KEGG   Danaus plexippus (monarch butterfly): KGM_210982Help
Entry
KGM_210982        CDS       T04344                                 

Definition
(GenBank) serine protease like protein
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
dpl  Danaus plexippus (monarch butterfly)
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dpl01002]
    KGM_210982
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     KGM_210982
Peptidases [BR:dpl01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   KGM_210982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-ProteinID: OWR48666
UniProt: A0A212F4K4
LinkDB All DBs
Position
Unknown
AA seq 451 aa AA seqDB search
MLGSKLHCGGAIITDQHVLSAGHCITFGVNFKDLTVYIGMHDRLGSTHTVSRLKNGVKHP
SFTSNAVRDINDIAILTLDKKLQFSDKVRPICLPSEGMDFKNVPLTVAGWGKTRQGALTS
SRYLLETKVKIVPSNTCSKSSIYKDNLVTDSMMCAYSLGKDACQGDSGGPIFATHARTHN
KKWYQVGIVSWGIDCAMPDYPECGTPSDKIISMRIVGGRRAEPHSFPWTVAIVKNDRMHC
GGAIITDRHVLSAGHCFKWDDRKQMKVYIGLDDLEDMNNVEVRNISNVVIHEQFTSTAVR
DENDIAIATLNKPVTFSDTIVPICLPSPGQKFDGRSGTIVGWGRLGTDKTSSKVLMKASL
RILSDEECFKSKLASHIKPMMMCAFTKGKDGCQGDSGGPLLTFESDGRYVQAGIVSWGIG
CANPNYPGVYTKVSNYNDWIEKNTANGKTCD
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatcgaaactacattgtggaggtgcaattattaccgaccaacacgttttaagt
gctgggcactgtatcacttttggtgttaattttaaagatctaaccgtctacataggaatg
catgatcgtttggggagcactcataccgtctctagactgaagaatggtgttaagcatccc
agcttcacttcaaatgccgttcgagacatcaatgacattgcgattttaacactcgacaaa
aagcttcaattttcagataaagttcgtccaatatgcttaccaagtgaaggaatggatttt
aaaaatgtaccactaactgtagccggatggggaaaaactagacaaggagctctaacatca
tcgagatatttattagaaactaaggttaaaattgttcctagtaatacgtgttccaagtcg
tctatatacaaagataatcttgtcaccgattccatgatgtgtgcttatagtcttggaaaa
gacgcttgtcagggtgatagcgggggaccaattttcgctacacatgcacgaacacataac
aagaaatggtaccaagttggtatcgtctcttggggtatagattgcgctatgccggactat
cctgaatgcggaacaccatcagacaaaataatatcaatgagaatagtgggtggtagaaga
gctgagcctcactcgtttccttggactgtggctatcgtgaagaatgatcgaatgcattgc
ggtggtgccataataacagaccggcatgtcctcagcgctggtcattgttttaaatgggat
gatagaaagcaaatgaaagtttatataggtctcgacgatttggaagacatgaataatgtt
gaagttaggaacatctcaaatgtggtcattcacgaacagttcacatcgaccgctgttcga
gacgaaaatgatatagcaatcgctactttaaacaaaccagttacgttcagtgacacaatc
gtaccaatatgtttgccttctccgggacaaaaatttgatggtagatcaggtactatagta
ggatggggtcgtcttggaactgataaaacatcttcgaaggttctaatgaaagccagtctt
cgaattctcagtgacgaggaatgttttaaatccaaattggccagccatataaagccaatg
atgatgtgtgctttcactaaaggaaaagacggttgtcagggcgacagtggtggaccactt
ttgacgtttgaatccgacggaagatacgttcaagcaggaattgtgtcgtggggtattgga
tgtgcaaacccaaattacccaggtgtgtacactaaagtgagcaactacaatgactggatc
gaaaagaatacagcaaatggaaaaacatgtgattaa

DBGET integrated database retrieval system