KEGG   Danaus plexippus (monarch butterfly): KGM_211182Help
Entry
KGM_211182        CDS       T04344                                 

Definition
(GenBank) putative annulin
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
dpl  Danaus plexippus (monarch butterfly)
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KGM_211182
Enzymes [BR:dpl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     KGM_211182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-ProteinID: OWR44550
UniProt: A0A212EST5
LinkDB All DBs
Position
Unknown
AA seq 745 aa AA seqDB search
MGAVKSKLAGCCPPRCVCCGYHRSDSYDLKDLPRPPRLDDSNNVIDGTRQGVLAVQGIDF
CIDSNGENHHTNKFNLMTRDVDRCLVVRRGQAFKLDILLNRPYDAKRDAVSFIFYVEDVE
KRGPSNEASAAVPMLEKGSETLGSWNAVYEGQIDSHLMVAVTPAADCIVAAWRLDVDTKL
SGTGALSYTHPRPIYIIFNPWCLNDSVYMPGHSHREEYVQEDGGLVFRGVYNRIKPAPWN
YAQYEKDILECALYLIREVGKVKGGARGDPIRIVRALAAAVNVQDDNGVLVGNWAKELSD
YSGGTHPLKWVGSLAIIQKYYEKKKPVKYAQCWVYAGVLTTLCRALGIPCRPVSGYDAAH
DSQGSLTIDIIKDENGDTLEEFTNDSVWMDRPDLGPDYGGWQAIDATPQETSEDVYRCGP
ASLRAVRDGELQKPYDVSYVFAQVNADKVLWKYSGEIQPLKLLARDTISIGQNISTKAIG
RMEREDITNLYKYPERTKEERDTMEKALRKSESIFARYYLNDAFNDVTFDFELRDDIKIG
QDFNVALHIKNRSTINEHHVKGVLRVDTVTYTGVTGDGVKRHEFDMKMAPEKKETITLPV
TFNDYLFFNQLASFNIACLASIVDRNFDYFAQDDFRVRNPDIKISIDGKPISRQEFTVNV
KLENPLPIPLKSGKFYIQGPGLDKQLKIELSENVPPGEFATAQFQLTPPWAGRHQISAKF
SSKEMHDVDGFLSIMVAPPASNGVS
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgtgaagagtaagttggctggctgctgtccgcctagatgtgtttgctgcggg
taccaccggtcagattcctacgatttaaaagatctgccgaggcctccacggttggatgat
tcaaataatgtcatcgacggaaccagacagggcgtcctcgcggtccaaggtatcgacttt
tgcatcgacagcaatggggaaaatcatcacactaataaattcaatctcatgacaagagat
gttgacaggtgtctcgtggtgagacgaggtcaggcttttaaattggatatcttattgaac
aggccatacgacgcgaaaagagatgccgtgtctttcatcttttacgtcgaagatgtggag
aagcgtgggccgtcgaatgaagcgtcagcggctgttcctatgttggaaaaggggtcggaa
actttaggttcgtggaacgctgtgtatgaaggacaaattgattcgcatctgatggtagct
gtgacaccagcggctgactgtattgtggctgcctggcgattggatgttgatactaagctc
agcggtaccggagcgcttagctacacacatccacgaccaatttatatcatttttaatcct
tggtgtcttaacgacagcgtgtatatgccaggacacagtcaccgcgaggaatatgttcaa
gaggatggtggtcttgtatttagaggtgtttataacagaattaaaccggctccgtggaac
tatgcccagtacgagaaagatattttagagtgcgctttgtatcttataagagaagttgga
aaggtcaaaggaggggcgagaggagatccaattaggatcgtccgagcgttggccgccgcg
gtaaatgttcaagacgacaatggtgttttggttggtaactgggccaaagaactgagtgat
tacagtggcggaactcatccgctgaaatgggtcggatctttggcgataatacagaagtac
tacgagaagaaaaagccggttaaatacgctcagtgttgggtgtacgctggggttttgacg
acattatgtagagcgcttggtatcccatgccgaccggtgtcaggttacgatgcagctcat
gacagtcagggtagtctcactattgacatcattaaagacgaaaacggcgacaccctggaa
gagtttaccaacgactcggtatggatggaccgtccagatttgggacctgattatggcggc
tggcaggccattgatgcgacgcctcaggaaacttctgaggacgtataccgctgtggccct
gcttccttgagggctgtccgcgacggagaactccagaaaccatatgacgtgtcttacgtc
ttcgcacaagttaatgcagataaggttctttggaaatactccggtgaaatacaaccatta
aaacttctagcacgtgatacgatatcaataggacagaatatatctacaaaagcaattggg
cgaatggaaagagaggatataacaaatctctacaaatatccggaacgaacaaaagaagag
cgtgacacaatggagaaggctctccgtaaatctgagagcattttcgcaagatattatcta
aatgacgcatttaatgatgtcaccttcgacttcgaattgagagacgatattaagatagga
caggatttcaacgttgcactacatataaagaaccgatctacaatcaacgagcatcatgtg
aagggtgtactgcgagttgacactgtgacgtacactggcgtcaccggggacggggttaag
aggcatgagtttgacatgaagatggcaccagaaaagaaagaaaccatcacactgcctgtc
acgttcaatgattatttattctttaaccaactagcgtccttcaacatagcttgtttggcg
tcgatagtcgacaggaactttgactatttcgcacaagacgacttcagagttcgcaatcct
gacattaagatctcgatcgacggcaaacctatttcacgacaggaattcaccgtaaacgtg
aaattggaaaatcctcttccgataccattaaagagcgggaaattctatattcaaggacca
ggattggataaacaacttaagatcgaactaagcgagaacgtgccaccaggcgagtttgcg
acagcccagtttcagttgacccctccttgggctggtcgtcatcagatatcagcgaagttc
tcctccaaggaaatgcatgacgtcgacggtttcctgtcgataatggtagcaccacctgcg
tctaatggtgtttcctag

DBGET integrated database retrieval system