KEGG   Danaus plexippus (monarch butterfly): KGM_212394Help
Entry
KGM_212394        CDS       T04344                                 

Definition
(GenBank) putative acid alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00052  Galactose metabolism
dpl00500  Starch and sucrose metabolism
dpl01100  Metabolic pathways
dpl04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KGM_212394
   00500 Starch and sucrose metabolism
    KGM_212394
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    KGM_212394
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpl04147]
    KGM_212394
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     KGM_212394
Exosome [BR:dpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KGM_212394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-ProteinID: OWR49877
UniProt: A0A212F808
LinkDB All DBs
Position
Unknown
AA seq 1095 aa AA seqDB search
MPKIPYKPEKGREEDEDYEIVSFEDFCDKPPGTSTDLLTLNDNINYRLHYETDKASNFPE
AGEPSTRDIGMHTETSLNGPKNASYKRKLSFAPFGRTDKNSRGPLFSGVIPKPRNEGESR
EHRYERFSPRGGWLARTWEQLGNLLPGMLATALLSALCVGAWWAVGGALSGSWGDDHYRR
LYERAHPDDIKKPLSPVIEKIIPTENRYHDHNNLSTKNKNITEASYKKDNKKSDYGDLDH
QCGDVSDSMRFDCHPQGGASEEACTKRGCCWGATAVQGAPYCYYPKHYPSYRFMNSTENK
HSMTVYYAHGLDTGYPGQWGTVMVTFNYLADDVLQIKMTDANNKRFEPPYPEVPVVSGRV
TSLQYRVLVDSAAVGFKVIRTEDNVTIVDTQNVGGLILSEKFLQLSSVLPTDHVYGLGEK
QAPLLNNFNWNTFTLFNSDMPPIENKSLYGTHPFYLALERNGKSHGMLLLNSNAMDIVLQ
PSPAITYRAVGGVLDFLVMMGPSPSQVVSQLTSLIGRPFMPPYWALGFHLCKYDYGSLNT
TRQVMQRNIDAGIPLDAQWNDLDYMSTANDFTYDKKKYEGLPQFVDDLHQKGMHYVVLVD
PGVSASETPGSYPPFDRGLEMDVFVKNSTDQPFVGKVWNPKSTVWPDFTNPNASVYWKEM
LEEFYKLVKFDGVWIDMNEPSNFLSGSMYGECDPEDLPYTPAETPQEGLKYKTLCMDAKH
YAGKHYDVHNVYAMAEAVVTFNAMREVRGKRPLVLSRASSPGLGRVAAHWSGDVYSKWHD
LKMSIPALLSFSLFGVPLMGSDICGFIGDTSEELCKRWMQLGAFYPFSRNHNSNEAKPQD
PVAMGAGVVRASRNALRTRYRMLPYYYTLFWKAHVAGETVARPLFMEFPSLSKVHSIDEQ
FMLGPHVLVSPILIPGNSTTALFPSTTWYSFLDGRYLARDRWMEIGEGDIISIRAGAILP
LQEPPSKGPVNTVVSRSGPLQLLVVPDKEGAAHGQLYWDDGDSINTYEEKKYSHIDFIVK
NNELQNIVQWWGYGVPSLNSISILGMKPLKSLTINDIPTKYTYINKTQVVTISSINLPLD
KTFRVKWTYQKTGKI
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagataccttacaaacctgaaaagggtcgtgaagaagacgaggattatgaaatt
gtatcttttgaagacttttgcgataagcctccaggaacgagtaccgatttattgacttta
aatgacaatattaactatcgacttcattatgaaaccgataaggcttcaaattttcctgag
gccggtgaaccatcaactcgagatattgggatgcacacggaaacttctttaaacggtccc
aaaaatgcgtcgtacaaaagaaaattgtcctttgcaccgttcggcagaaccgataaaaat
agccgcggtccattattcagtggagttataccgaaacctagaaatgaaggggaatctagg
gaacacagatacgaacgtttctctccgcgtggcggttggctagcgcgtacctgggaacag
ctagggaatttgttacctggtatgctagctacggcgttgttgagcgcgttatgcgtgggc
gcatggtgggcggtgggcggagctctaagcggcagctggggagatgatcattacagacgt
ctctacgaacgcgctcatccagatgacataaaaaaaccactgtcgcctgtaattgagaag
attattccgactgagaaccgctaccacgaccacaacaatttgtcaaccaagaacaagaac
atcacagaagcgtcttataagaaggataataagaaaagtgactacggcgatttggatcat
cagtgtggtgatgtatcagacagcatgaggttcgactgtcatccgcaggggggcgccagt
gaggaagcttgtaccaaacggggttgttgttggggggcgaccgctgtgcagggtgctcca
tactgctactaccctaaacactacccgagctaccgcttcatgaacagcacagagaacaag
cacagcatgaccgtgtactacgctcacggtctggatacagggtaccctggacagtgggga
actgtcatggtgaccttcaactacctggccgatgatgtcctgcagattaagatgaccgac
gctaacaacaagaggttcgaacccccgtaccccgaggtgccggtggtgtcggggcgggtc
accagtctccagtaccgagtgctggtggacagtgccgccgtcggcttcaaggtcatcagg
actgaggacaacgtcaccatagtcgacactcagaacgtgggtggtttgatattatcggag
aaattccttcagttatcgtcagtactgcccacggaccacgtgtacggcttgggagaaaaa
caggcgccgctcctgaacaacttcaattggaacaccttcacgctgttcaacagcgacatg
ccgcccatagagaataaaagtctctatgggactcatcctttttatctggccttggagaga
aatgggaagagtcatgggatgctcctgttgaattcgaatgctatggacatagtcctccaa
ccgtctccggctataacgtaccgcgccgtgggcggcgtcctagacttcctggtgatgatg
ggtccttcgccctcgcaagttgtatctcaactcacgagccttataggcagacccttcatg
ccgccgtactgggcgctcggattccatctgtgcaaatacgactacggcagcctcaacacc
acccgccaggtcatgcagaggaacatcgacgccgggataccgttggacgcccagtggaat
gacctggactacatgagcactgcgaacgacttcacgtacgacaagaagaagtatgaaggc
ctgccgcagttcgttgacgacttgcatcagaaaggaatgcactacgtagtgctcgtcgat
cccggggtgagtgcgtccgaaactccgggcagctacccgcctttcgaccggggattggaa
atggacgtgttcgtgaagaactccaccgaccagcccttcgtggggaaggtctggaatcca
aagtcgacggtgtggccggacttcaccaaccccaacgcgtcggtttactggaaggaaatg
ttggaggagttttataagctggttaaattcgacggagtgtggatcgatatgaacgagccg
tccaacttcctgtcagggtctatgtacggtgaatgtgaccccgaggaccttccctatacc
cccgcggagactcctcaggagggtctcaagtataagaccctgtgtatggacgccaagcat
tacgcggggaagcattacgacgtgcacaacgtctacgccatggcggaggccgtggtcaca
ttcaatgctatgcgtgaggtccgtggtaagcgtccgttggtgttgtctcgagcgtccagt
cccggcctgggaagagttgctgcccactggagtggagacgtctacagcaaatggcacgac
ctcaagatgtctatacccgccctgctgagttttagcttgttcggcgtgccactgatgggt
tccgacatctgtggcttcatcggcgatacttctgaagagctttgcaagagatggatgcag
cttggagctttctatccattctcacggaaccataattccaatgaagccaagccccaggat
cccgtggccatgggagcgggcgtggtgcgagcgagtagaaatgcgctccgcacgaggtac
cgcatgctgccatactattacacactcttctggaaggcccacgtggcgggggaaacggtc
gccaggccgctgttcatggagttcccatctctgagtaaagtccactcaatcgatgagcag
ttcatgttgggtccgcacgtgttggtgagccctatactcatccccggtaactcgaccacg
gcgttgttcccctccaccacttggtacagcttcctggatggaagatacctggccagagac
cgatggatggaaatcggagaaggggatatcatatccatcagggcgggtgcgatccttcca
ctccaagagccgccgtccaagggacccgtgaacacggtcgtgagccgcagcggccctctc
cagctgttggtggttcccgataaagaaggagcggctcacgggcagctctactgggacgac
ggagacagcatcaatacctatgaagagaaaaagtatagccacatcgatttcattgtgaag
aacaatgagctacagaatatagtacagtggtggggatatggggttccatctctcaactct
atctccatactggggatgaagcccttaaagtccttgaccatcaacgacatccccaccaaa
tacacatatattaacaaaacccaagtggttactatctcttccataaatctgccattagat
aaaacatttcgtgtaaaatggacctaccaaaaaacaggaaaaatataa

DBGET integrated database retrieval system