KEGG   Danaus plexippus (monarch butterfly): KGM_215725Help
Entry
KGM_215725        CDS       T04344                                 

Definition
(GenBank) Histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
dpl  Danaus plexippus (monarch butterfly)
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpl01009]
    KGM_215725
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dpl03019]
    KGM_215725
   04131 Membrane trafficking [BR:dpl04131]
    KGM_215725
   03036 Chromosome and associated proteins [BR:dpl03036]
    KGM_215725
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KGM_215725
Protein phosphatases and associated proteins [BR:dpl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KGM_215725
Messenger RNA biogenesis [BR:dpl03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     KGM_215725
Membrane trafficking [BR:dpl04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    KGM_215725
Chromosome and associated proteins [BR:dpl03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     KGM_215725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-UBP_var
Motif
Other DBs
NCBI-ProteinID: OWR42102
UniProt: A0A212EKT9
LinkDB All DBs
Position
Unknown
AA seq 1196 aa AA seqDB search
MGGKAKPTNVGLLNIPITTTVANTATQFKECPDTNHRRTEKNIVSNAFEKLLQQYTNTTY
ELAKMSTSSSPTAARRTASEVKKTSPSSIVTRNGARKAKIQTRAMAAAKPSASVVAAKRK
AQQKKKFTMDTVLRDPYQTAMESKFKVKGATGFVTDPRMSEHRCLWDDNYPECPERLISV
INRCQELNLIEQCKVYPPRSATREEVLELHSPSVYSMMEGTHQNQDLEYLEELSAGFDAV
YIHPTTHELALSSAGCTLDMVERLVSDELQNAACMVRPPGHHAMRAEPCGYCIYNNAALA
ANRALKLGLQRILIVDWDVHHGQATQQMFYDDPRVVYFSIHRYEHGAFWPNLRQSDFPYI
GSGQGEGHNFNVPLNNTGMTDADYIAIWHQLLLPMAFEYQPQLVLVSAGYDAAVGCPEFS
PELIIVSAGYDAALGDEKGEMEVTPACYASLLHMLQGVCSRVLVLLEGGYCLRSLAEGAA
LTLRTLLGHAPPALPPLQEPCESIRDSILNCIYSHKKHWRCFNNQPSYSIDPSVLNTGER
GVGQHTVVMKWEGDETRADRFATRNCYPLQTDDTRKRIQDRLNHLQLATDVSCSEHPVCY
IYDPAMLKHHNVCEPGHVECPERIMRIHERHRDFGLLERVHRLPPRSAADDEILAVHTEK
YLDSLKELSSTKLRDLNAQRKSFDSVYFHPDSLQSAAAAAGAVIQMVDAVLRHGSGGVCV
VRPPGHHADEDVPSGFCLLNNVAVGARHARAAHGLTRIMILDWDVHHGNGTQRITYEDKE
ILYISIHRYDNGSFFPNSPAADHTAVGQGRGEGYNINIPWNKRGMGDAEYLSAMCSVVLP
VAYEYGPQLVLVSAGFDAAVGDPLGGCKVTPECYGRMTHMLRGLAGGRVIVCLEGGYNVT
SISYAMTMCTKALLGDPLQHQYDPKQTVNPSAVESINNVIRTHQKYWKSLKFQLALPMED
VIGPLPKSRGLPDSEPAPDHAKIVSDKLKKYAHDNNLAKEISNLSIRNDCTDGIHCGTDD
ENDDGVHKTKTNDGAGASHGTGSAGPSGNKQNRTGSEPTTLVDYLSENMQAIVNEEMFAV
IPLTWCPHLDMLHAVPEGVHFQQGVQCVSCDHVEENWVCLHCYITACGRHVNGHMQDHFK
AAQHPLSLSLSDLSVWCSVCDAYVDNHLLYDAKNNAHRCKFGEDMPWCYNNTIQMH
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atgggagggaaagcaaagccaacaaacgttggtctattgaatataccaattactactaca
gttgctaacacagccacccaattcaaagagtgccctgacaccaaccataggaggacagag
aaaaatattgtttcaaatgcatttgagaagcttctgcagcagtataccaataccacatac
gaactcgcaaaaatgtcgacctcgagttcgccgactgcggctcgtcgtaccgctagtgag
gttaaaaagacatctccttcatctattgttacaagaaatggtgctagaaaagccaaaata
cagacacgtgctatggcagcagcaaagccgtcagcgtctgtggtggcagccaaacggaag
gctcagcagaagaaaaaatttacaatggacacagtgcttagagatccttatcaaacggcc
atggagtctaaattcaaagtgaagggtgctacaggctttgtgactgaccctcggatgtct
gaacaccgttgcctatgggatgataactatccggagtgtcccgaaagactgataagtgtc
attaacagatgtcaggagctgaatctaatagagcagtgtaaagtgtatcctccccggagc
gccacccgcgaggaggtgttggaactgcactcgccatccgtctacagtatgatggaggga
acccatcagaaccaggacctggagtatttggaggaactgtctgctggcttcgatgcggtt
tatatacaccctactactcacgagctggctttatcgtctgctggttgtaccctggatatg
gtggaacgcctggtctccgacgagctgcagaacgccgcgtgtatggtgaggccgcccgga
caccacgccatgagggcggagccctgtggatactgtatctacaacaacgcagccctcgcg
gcgaatagggctctcaaacttgggctacagagaatattaatagtggactgggacgtgcat
cacggacaagccacacaacagatgttctacgacgatccgagagtggtgtacttctccatc
catcgttacgagcacggggcgttctggcccaacctgcggcagtcagacttcccttacata
gggagcgggcagggcgagggtcacaacttcaacgtgcccctcaacaacaccggcatgacg
gacgcggactatatcgctatatggcatcagttgttactgcccatggcttttgagtaccag
ccgcagctggtgctggtgtctgcgggatacgatgccgcagtcggctgtcctgagttctcc
ccagaactgatcatagtgtcagctggttatgatgccgcactcggtgatgagaagggtgag
atggaagtgacccccgcgtgctatgcctccctcctgcacatgctgcagggagtgtgctcc
cgcgtgttggtgctgctagagggcgggtactgtctgcgctcgctggccgagggcgccgcc
ctgacgctgcggacgctactgggacacgcgccgcccgccctgccgccgttgcaagaaccg
tgcgaatcgataagagattcgatcctgaactgtatatactcgcacaagaaacactggagg
tgcttcaacaaccagccgagctacagcattgacccctccgtgttgaacacgggcgagcga
ggggtaggtcagcatacagtggtcatgaagtgggaaggggatgagaccagagccgacagg
ttcgccaccaggaactgctatccattacagaccgacgacaccaggaagaggatccaggac
agactgaaccatttacaattggccacggacgtcagctgctccgagcaccccgtgtgttac
atctacgacccggccatgttgaagcatcataatgtttgtgaacctggccacgtggagtgt
ccagaacgtataatgcgtatacatgagcggcacagggatttcggtctgttggaacgcgtc
caccgcctgccgcccaggagcgccgccgacgacgagatactcgctgtgcatactgagaag
tatctagatagcctgaaggagttgtcgagtacgaagcttcgagatctgaacgcacagagg
aagtccttcgactctgtatatttccaccctgactccttacaaagcgccgcagccgctgcc
ggcgccgttatacagatggtagacgccgttctaagacacggcagtggcggagtgtgcgtg
gtccggccgccgggacatcacgcggacgaggacgtgccgagcgggttctgtctcctcaac
aacgtggcggtgggcgccaggcacgctcgcgccgcccacggactgaccaggatcatgata
ctggactgggacgttcatcacgggaacggcacgcagaggatcacatatgaagataaagag
atactgtacatatcgatccaccgctatgacaacggctcgtttttccccaactcccccgcg
gccgaccacaccgccgtgggccagggtcggggggaggggtacaacattaacataccgtgg
aataaacgaggtatgggagacgcggagtatctgtcagcgatgtgttccgtggtgttgccg
gtcgcctacgagtacgggccgcagctcgtgctggtgtcggccggcttcgacgcggccgtc
ggagatcccctcggaggttgcaaagtaacgccggagtgctacgggcggatgacgcacatg
ttgcggggtctggccggggggcgggtcattgtgtgtctagagggcggctacaacgtcacc
agcatatcgtacgccatgaccatgtgcactaaggccctcctcggagacccgctgcaacat
cagtacgaccccaaacaaacggtcaacccgtccgccgtggagagcatcaataacgtgatc
agaacacaccagaagtattggaaatctctaaagtttcaactagccctgcccatggaggac
gtcattggcccgctccccaaatccagaggcttacctgactccgagccggcgccggaccac
gctaagatcgtgagcgacaaactgaaaaaatatgcacacgataataatctagcaaaagaa
atatcaaacttgagcataaggaacgactgcaccgacggcatccactgcggcaccgacgac
gaaaacgatgacggcgttcataaaactaagacaaacgacggcgccggcgccagccacggg
actgggagtgcggggcccagcggcaataaacagaaccgcacgggaagcgaacccacgacc
ctagtggactatctctcggagaacatgcaggccatagtcaacgaggagatgttcgctgtg
atacctttaacctggtgccctcatctcgacatgctgcacgccgtccccgagggcgtgcac
ttccaacaaggagtccaatgtgtcagctgtgatcacgtagaagagaattgggtctgtctg
cactgttacattaccgcctgcggcagacatgtgaacggtcatatgcaggaccacttcaag
gcagcgcagcatcccttatcgctgtctctctccgacctctcggtgtggtgcagtgtgtgc
gacgcctacgtcgacaaccatctcctctacgacgccaaaaacaacgcccacagatgtaaa
ttcggcgaagacatgccctggtgctataacaatacaatacaaatgcactga

DBGET integrated database retrieval system