KEGG   Danaus plexippus (monarch butterfly): KGM_215828
Entry
KGM_215828        CDS       T04344                                 

Definition
(GenBank) buffy
  KO
K20017  Bcl-2 family protein
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl04214  Apoptosis - fly
dpl04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    KGM_215828
   04215 Apoptosis - multiple species
    KGM_215828
SSDB
Motif
Pfam: Bcl-2 ACC_epsilon
Other DBs
NCBI-ProteinID: OWR49645
UniProt: A0A212F7C9
LinkDB
Position
Unknown
AA seq 324 aa
MSDGKLVQENNNISIHVTPPDGEEDDEFVPPLRMRRKLSTPLSALPGSIERLHATELLRL
SPVRCLSPLDRTKRRFSTMVSSAAAAAVSRRLSATIGWCLATPTQVKPQIVRQGRALCLQ
YIKTQIRRSSSCPNKQIVLKRLQRMLETECGEEATNNIESGVLAALRALCAALERKRPEA
FRHVARQATRAPSAMLRSDTALAELTLALARRITRENITWSKIAAVYCICGALAREAAEA
GDGEPPLELVSSPAAAIADLLHEDPGSWIASHGGWNGLIERLRISERDQRSEKTLRVMVS
FFALACCFLLLLRWVIHTNPAYDE
NT seq 975 nt   +upstreamnt  +downstreamnt
atgtcagatggaaagttagttcaagagaacaacaacatttccatccatgtgactccaccg
gatggagaagaagatgatgaatttgtaccgccgctacgaatgcgacggaaactcagcaca
ccgctaagtgctttaccaggatcaatagagagacttcatgctacagaactattaagacta
tcaccagtaagatgtttatctccgttggatcgcacaaagcgtcgcttcagcacgatggta
tcaagcgctgcggcagctgcagtatcacgacgtctctctgcaactatcggatggtgcctc
gccacacccacgcaagtcaaacctcaaatagtccgccagggtcgtgcactttgccttcaa
tacattaaaacacaaataaggcgatcatcgtcatgcccaaataaacaaatagtattaaaa
cgtctgcaaagaatgctggaaactgaatgtggtgaggaagctacgaataatatagaaagc
ggtgttctggccgcgttacgggctttatgtgctgctttagagagaaaaagacccgaagcg
tttagacatgtagcgcggcaggctacaagagcgccttcggctatgctgcgatcggataca
gcccttgctgagttgacgcttgcattagctcgtcgtattaccagagaaaacataacatgg
tccaaaatcgctgctgtgtattgtatatgtggagctctggcaagggaggcggcagaggca
ggagatggggaacccccgcttgaactagtgtcgtcaccagccgcagccatagcagacctt
ctccacgaagatcctgggtcctggatagcatctcatggtggctggaacggacttatcgaa
agactacgcatcagtgaacgcgaccaacgatccgagaaaacacttcgagttatggtgtct
ttctttgcattggcatgctgctttctgttactactaagatgggtcatccatacaaatcca
gcctatgatgaataa

DBGET integrated database retrieval system