KEGG   Dialister pneumosintes: BCB69_00320Help
Entry
BCB69_00320       CDS       T04459                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
dpn  Dialister pneumosintes
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AOH38572
UniProt: A0A1B3WC66
LinkDB All DBs
Position
68308..69795
Genome map
AA seq 495 aa AA seqDB search
MNKVALQEKYDLFIGGQWVPSSDGVYSDAHNPATGEKLASFAEATKEDVDAAVKAAHKAF
PSWAAVEPVERQNILLKIADIIDANKERLALIETMDNGKPIRETSTVDIPLGADHFRYFA
GAVRIEEGSAKILDGNNLSLILREPIGVVGQVVPWNFPFLMACWKLAPALAAGDTIVLKP
SSHTSLSVLELVRLIQDILPAGVLNVITGAGSKSGQYLLDHPDVDKLAFTGSTSVGKGVY
KAAGEKLVPVTLELGGKSANIILDDANMEQALEGVATGILFNQGQVCCAGSRVFVQEGIY
DEFLQRLKDTFESVKIGDPTDPETQLGAEIYKKQMEKVAGYVDIARQEGCRIVTGGERYT
ANGCDKGYFFKPTIIEADNNKLRICQEEVFGPVVVIQKFSSVDEVIKLANDSEYGLGGGV
FSTNIHTALKIARNVRTGRIWVNCYNLIPAGAPFGGYKKSGIGRETHKMILNAYTQVKNV
MINMNEGPSGLYNVK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtagctcttcaagaaaaatatgatttatttatcggtggacaatgggtaccg
tcctctgatggtgtatatagtgatgcacataatccggcaaccggagagaagttggcatct
tttgcagaagcgactaaagaagacgtggatgcggcagtaaaagctgcacataaagcattt
ccttcgtgggcagctgtagaaccggtagaacgtcagaacatcttgcttaagattgcggat
attattgatgcaaacaaagaacggttagcattaattgaaactatggataacggtaagccg
attcgtgaaacttctacggtagatattcctctcggtgcagaccatttcagatactttgca
ggtgctgtgcgtattgaagaaggtagcgccaaaatattggatggaaataatttatcttta
attttacgggagccgattggtgttgtagggcaggttgttccttggaatttcccgttcctt
atggcatgttggaagttggcgcctgcattggcggcaggagatacgattgtattaaaaccg
tcttctcatacttctttatctgtattggaattagttagattaattcaggatattcttccg
gcaggggtgttgaatgttattacaggagcgggctctaagtccggacagtatctcttagat
catccggatgtagataaactggcatttaccggctctaccagtgtaggtaagggtgtgtat
aaagcagcaggtgaaaaattggttccggttactttggagttaggtggtaaatctgcgaat
atcattcttgatgatgctaatatggagcaggcattggaaggagttgctacaggtattctt
ttcaatcaaggtcaagtttgctgtgccggttcacgtgtgtttgtgcaagaaggaatttat
gatgaattcttgcagcgtttaaaagacacttttgaatccgtaaagattggcgatccgact
gatccggagacacagttgggggctgaaatctataagaaacagatggaaaaggttgccggt
tatgtagatattgcgcgtcaggaaggttgccgcattgttaccggtggggaaagatatact
gctaatggttgtgataaagggtatttctttaagccgaccattattgaggcggataataac
aagcttcgtatttgtcaggaagaagtattcgggccggtagttgttattcagaaatttagc
tctgtagatgaagtaattaagctggctaatgattctgaatatggtcttggtggcggtgtg
ttctccactaatattcatacagcacttaagattgctcgcaatgtaagaacgggacgtatt
tgggtcaactgttataacttaattccggcaggtgctcctttcggcggttataagaaatcc
ggtatcggcagagaaacacataagatgattctcaatgcgtatacacaggttaagaatgtt
atgattaatatgaatgaaggaccttccggattgtataatgtgaagtag

DBGET integrated database retrieval system