KEGG   Dialister pneumosintes: BCB69_02865Help
Entry
BCB69_02865       CDS       T04459                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dpn  Dialister pneumosintes
Brite
KEGG Orthology (KO) [BR:dpn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCB69_02865
Enzymes [BR:dpn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BCB69_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored FAD_binding_2 HI0933_like Lycopene_cycl Thi4 DAO NAD_binding_8 DUF5517
Motif
Other DBs
NCBI-ProteinID: AOH39629
UniProt: A0A1B3WF93
LinkDB All DBs
Position
complement(572417..573325)
Genome map
AA seq 302 aa AA seqDB search
MYDTIVIGGGPAGLTAALYAIRKEMSTVLISPDIGGQMLLTNEIENYPGFESILGFDLSD
KMESHVRKYPVSFEMASVEKLKRLPDGHFSVELDDGKQIIGKTVIVTAGKRNRTLNIDGE
SRLTGRGVSYCATCDGPFYKNKVTAVVGGGDSAIQAAIEMASISKQVYLLVRSKIRASEI
LVSRLNKLPNIKVMLGYSPVKIIGEDKVVGIDIRNNLTEEESSISLDGIFIEAGGIPNNG
YLPESVTTNKSGEIISDKYGVTNISGLFAAGDVTDRKDKQVVIAAGEGAAAALAAHDYLL
RH
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atatatgatactatcgtaattggaggaggtccggcaggacttactgcagcgttatatgct
attcgcaaagaaatgtctactgtgcttatttctcctgatatcggtgggcaaatgttattg
actaatgaaattgaaaattatccgggatttgaatcgatattaggttttgatttatcagat
aaaatggaaagccatgtaagaaaatatccggtgtcatttgaaatggcttctgttgagaaa
ttaaaaagattacctgatggtcattttagtgtggaacttgatgatggaaaacaaattatt
ggtaaaactgtaattgtaactgccggtaaacgaaatcgtacattgaatattgacggggaa
tcgcgattaacaggacgtggtgtaagttattgtgcaacttgtgatggtcctttttacaag
aataaagtgacagcagtagttggtggtggtgatagtgctattcaagctgctattgaaatg
gcttctatatccaaacaggtatatttgttagtacgtagtaagatacgagcttcagaaatt
ttagtttctaggttaaataagttaccaaatataaaagttatgctaggatattctccggtt
aaaattataggtgaagataaagtagttgggatagatataagaaataatcttacagaagaa
gagtcttctatatctcttgatggtatttttatagaagcaggtggaattcctaacaatggt
tatcttcctgaaagtgttactactaataaatcgggagaaattattagtgataaatatgga
gttacaaatatttccgggttatttgctgcaggagatgttaccgatcgtaaagataaacaa
gtagtaattgctgccggtgaaggagcagcagcggctttggcagcacatgattatttactt
aggcattaa

DBGET integrated database retrieval system