KEGG   Dialister pneumosintes: BCB69_02970Help
Entry
BCB69_02970       CDS       T04459                                 

Definition
(GenBank) hypothetical protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
dpn  Dialister pneumosintes
Pathway
dpn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dpn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BCB69_02970
Transporters [BR:dpn02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    BCB69_02970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_8 SBP_bac_6 SBP_bac_1 NMT1
Motif
Other DBs
NCBI-ProteinID: AOH39024
UniProt: A0A1B3WDH3
LinkDB All DBs
Position
complement(596147..597184)
Genome map
AA seq 345 aa AA seqDB search
MKRFISVVFFLIVSIAILGSVYYKAKKQDIQRQSVAQSTKTLYVYTDMSLELIHAVAKLF
EMKTGITVDVIPLTENQILDASLRTAQQADIVISSQEVLQQLSTKQQLHPFISEQTDTVL
YPYRAENGLWTGVWIDPIIFIVNPTFYKENFDILYTWDSVIQNMDIRISVTDFVTSRESE
NLLYCMGEHFGDEETLMRLLQLGKHVVQYGKYLSTPVRMVAMNKADVGISNYSEAMRAKK
EQFPVQIIYPDDGQPWYLYGIGIYKDAPNFELAGEFVDWVLSEDLKNTMGEVGTYYLLTN
DVMQEKDDRGCLLDLWDLKKVFVKEGRDAFKKEWISEVRFAKKAE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttttatttctgtagtttttttcttgattgtttcaatagcaattttagggagc
gtatattataaagctaaaaaacaagatattcagagacaaagtgttgcacaatctacaaaa
acattatatgtgtatacagatatgtcacttgaattgattcatgctgtagcaaagcttttt
gaaatgaaaacaggaattacagtagatgttatacctcttacagagaatcaaatacttgat
gcctctttacgtacagctcaacaagcagatattgttatttcttctcaagaagtattacaa
caattgagtacaaaacagcaattacatccttttatttcggagcaaacagatactgtactt
tatccatatagggcagaaaatggtttatggaccggtgtgtggatagaccctattatattt
attgttaatcctactttttataaagaaaattttgatattttgtatacatgggatagcgtt
atacaaaatatggatatacgtatttctgtgactgatttcgtaacttctagagaatcagaa
aatttattgtattgtatgggggagcattttggtgatgaagaaacattaatgcgtctcttg
caattaggaaagcatgttgttcagtatggtaaatacctatcaactcctgtgcgtatggtt
gcaatgaataaagcggatgttggcatatctaattattcagaagcgatgcgtgcaaaaaaa
gaacagttccctgttcaaattatttatcctgatgatgggcaaccttggtatctttatggt
ataggaatttataaagatgctcctaattttgaactggcaggagagtttgttgattgggtg
ttatctgaagatttaaagaatactatgggagaagtagggacttattacttgcttactaat
gatgttatgcaagaaaaagatgatagaggatgtcttttagatctttgggatttaaaaaaa
gtatttgtaaaagaaggacgagatgcttttaagaaagaatggatttctgaagttagattt
gcaaaaaaggcggagtaa

DBGET integrated database retrieval system