KEGG   Dialister pneumosintes: BCB69_03730Help
Entry
BCB69_03730       CDS       T04459                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dpn  Dialister pneumosintes
Pathway
dpn00970  Aminoacyl-tRNA biosynthesis
dpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCB69_03730
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dpn03029]
    BCB69_03730
Enzymes [BR:dpn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BCB69_03730
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BCB69_03730
Mitochondrial biogenesis [BR:dpn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BCB69_03730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AOH39149
UniProt: A0A1B3WDW6
LinkDB All DBs
Position
complement(753071..754516)
Genome map
AA seq 481 aa AA seqDB search
MKYEAVIGLEVHTELQTATKIFCNSKTSFGAPPNTNVSPVCLGLPGVLPVLNKKVLEFAV
RAGLALNCEIARFSKFDRKNYYYPDLPKNFQTSQFDLPICKEGYLDVEVDGEVSRIRITR
AHMEEDAGKLVHHGDSITTADYSLVDYNRTGTPLLEIVSEPDIRSAKQAVAYMEKMRAIL
QYCGISDCRMEEGSLRCDANISVRPVGQKELGTKTEIKNINSFKGVEKAIEYEAIRQAKI
LEAGGTIKQETRTWDEKEGVTKSMRSKEEANDYRYFPEPDLVPFTVSDEYIEKIRQTLPE
LPDARKARYMESFGLSSYDADYLTNDKARADYFEAMVKAGAEPKEACNWLMGEFAGKLSE
NGIEITESPVTPEGLAALLTLISKGTISGKIAKQVFPEMWETGKAAEEIVKEKGLIQISD
TSELEAIVMEVIQANPKSVEDFKAGNKKAVGFFMGQIMKATKGKANPRVVSGMVMKKLQE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgaagcagtcatcggtcttgaagtgcatacagaacttcaaacggctactaag
attttttgtaatagtaaaacttctttcggagcacctccgaatacgaatgtttctcccgta
tgtttagggcttccgggggtattacctgttttaaataaaaaggtattggaatttgcagtt
cgtgccggtttggcattaaattgtgaaattgcaagatttagtaaatttgatagaaaaaat
tactattatccggatttgccgaaaaatttccagacatcacagtttgatcttccgatttgc
aaggaagggtatttggatgtagaagtagatggagaagtcagccgtattcgtatcactcgt
gctcatatggaagaagatgcgggaaaattggttcaccacggtgattctattacaacggcg
gattattctttagttgactataaccgtacgggtacgccacttttggaaattgtatcggaa
ccggatattcgttctgctaaacaggcagtcgcttatatggaaaagatgcgtgctattctt
cagtattgcggtatttccgattgccgtatggaagaaggttctttgcgttgtgatgcaaat
atttccgtacgtcctgtaggacaaaaggaattgggaacaaagacggaaattaagaatatc
aactcttttaaaggtgttgaaaaagcgattgaatatgaagcgattcgtcaggctaagatt
ttagaagccggcggtactattaaacaggaaacccgaacttgggatgaaaaagaaggcgta
actaagagtatgcgttctaaggaagaagctaacgattatcgttacttcccggaaccggat
ttagttccgtttactgtatcagatgaatatattgaaaagattcgtcagacactccctgaa
cttccggatgcacgcaaggctcgttatatggaatctttcgggttatcttcttatgatgct
gattacttaactaatgataaggcgagagcggattactttgaagcaatggttaaagcaggt
gcggaacctaaggaagcttgtaactggcttatgggagaatttgccggaaaactttctgaa
aacggtattgaaattacagaatcacctgttacaccggaaggactggcagcattacttact
ttgatttctaagggaactatttccggcaagattgctaaacaggtattcccggaaatgtgg
gaaaccggtaaagcggcagaagaaattgttaaagaaaaaggattaattcagattagcgat
acttcagaattagaagccattgttatggaagttattcaagcaaatccgaagtctgttgaa
gactttaaggcaggtaataagaaggctgtcggcttctttatggggcagattatgaaagct
actaaggggaaagcaaatccacgtgtagtaagtggtatggttatgaagaagttgcaagaa
ttatga

DBGET integrated database retrieval system