KEGG   Dialister pneumosintes: BCB69_04735Help
Entry
BCB69_04735       CDS       T04459                                 

Definition
(GenBank) amino acid ABC transporter substrate-binding protein
  KO
K10036  glutamine transport system substrate-binding protein
Organism
dpn  Dialister pneumosintes
Pathway
dpn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dpn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BCB69_04735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dpn02000]
    BCB69_04735
Transporters [BR:dpn02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamine transporter
    BCB69_04735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: AOH39657
UniProt: A0A1B3WFB9
LinkDB All DBs
Position
complement(947357..948130)
Genome map
AA seq 257 aa AA seqDB search
MGKKCKLALAVGMIAAVVTGVVGCGSSNSNNDKVIRVGAETTFPPFEFVENEKYVGFDLD
LADAVIKQMGGKMEFKSMGFDALIPAIQSNQIDLIASGMDATPERAKKVLFSEPYFEQNG
YVIVVKKDNDNIKNWTDLSGKVVGAQVGTEQVGLAKEQGASDVKQLDSISQAFMELKAGT
VDAVVLDHPVSMYYLKQGADQDAKIVGEAKQGAPLVFAMNKNNEQLQQDVNKAMKELKEN
GTYDKIYQKWFGSSEVK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaaatgtaaactggctttagcagtcggtatgattgctgccgttgtaaccggt
gtagtaggttgtgggagttcgaattccaataatgataaagtcattcgtgtaggggcagaa
acgacattccctccatttgaatttgttgaaaatgaaaaatatgtcggatttgatttagat
ttagcagatgctgttattaaacaaatgggtggaaaaatggagtttaagagcatgggtttt
gatgctttgattcctgctattcaaagtaatcaaattgacttgatagcttcaggtatggat
gcaactccggaacgtgcaaaaaaagtgttattcagtgaaccttattttgaacaaaatggc
tatgttatcgtagtgaaaaaagataatgacaatattaaaaattggacagatctttccggc
aaggttgtcggtgcacaagtagggactgaacaagttggtcttgcaaaagagcaaggagct
tccgatgtaaaacagttggattctatttcacaagcttttatggaattaaaagcagggact
gttgatgcagtagttttagatcatccggtaagtatgtattatttgaaacaaggggcagat
caggatgctaagattgtaggcgaagcaaagcaaggggctccattagtatttgcaatgaat
aagaataatgaacagcttcaacaagatgttaataaggcaatgaaagaacttaaggaaaat
ggtacttatgataaaatttaccagaagtggttcgggtcatctgaggttaaataa

DBGET integrated database retrieval system