KEGG   Dialister pneumosintes: BCB69_05905Help
Entry
BCB69_05905       CDS       T04459                                 

Definition
(GenBank) restriction endonuclease
Organism
dpn  Dialister pneumosintes
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII NERD EcoRII-C
Motif
Other DBs
NCBI-ProteinID: AOH39515
UniProt: A0A1B3WEW6
LinkDB All DBs
Position
1202007..1202849
Genome map
AA seq 280 aa AA seqDB search
MRDFEEWLSKMRPSINTYQYYVDFYKVYTNVESIKIELNLLNSLIHSKNIKQDFITLTKK
YPEILKCIPILLAVRQKEIYVQDEEGAYLINFDKLNYSIEEYVLFMEKTGLFDLIENHII
NNLVDYVLGVETGLDSNGRKNRGGHQMENLVERYIKKTGFEYYKEMYLTEIEKKWNVDLS
TISAEGITTKRFDFVIKSPHKLYLIETNFYASGGSKLNETARSYKMITTEVESIPFVEFL
WVTDGGGWKSARRNLKETFEVMQHLYNINDLENNVLQKLE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagagattttgaagagtggctttctaagatgcgaccaagcattaatacatatcagtac
tatgttgatttttataaggtatatacaaatgtagaatctattaaaatagaattaaattta
ttaaactcattaatacactctaaaaatataaaacaggattttataacacttacaaaaaag
tatcctgaaattttaaaatgtattcctatattattggcggttcgtcaaaaagaaatttac
gtacaagatgaagaaggtgcttatttaattaattttgacaagcttaactatagtatagaa
gaatatgtactttttatggaaaagaccggattatttgatttaatagaaaatcatattatt
aataatctggtggattacgtgttaggtgtagaaaccggactggatagtaatggaagaaaa
aatcgcggtggacatcaaatggaaaatttggtggaacgatatattaagaagaccggtttt
gaatattataaagaaatgtatttaacagagattgagaagaaatggaatgtggatttatca
actatatcagcagaaggcattactacaaaacgttttgattttgtgattaaatcaccacat
aagctatatttgatagaaaccaatttctatgcgagcggtggctctaagcttaatgaaaca
gcaagaagttataaaatgattacaacagaagtggagagtattccgtttgtagagttttta
tgggttacagatggtggtggatggaagtccgctcgtcgtaatttaaaagaaacttttgaa
gtcatgcaacatttgtataacattaatgatttagagaacaatgtattgcaaaagctagaa
taa

DBGET integrated database retrieval system