KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10351
Entry
Dpse_GA10351      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K16340  PH domain and leucine-rich repeat-containing protein phosphatase [EC:3.1.3.16]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpo01009]
    Dpse_GA10351
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dpse_GA10351
Protein phosphatases and associated proteins [BR:dpo01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    Dpse_GA10351
SSDB
Motif
Pfam: LRR_8 LRR_4 PP2C LRR_9 DUF2857
Other DBs
NCBI-GeneID: 4817886
NCBI-ProteinID: XP_001357239
FlyBase: FBgn0070409
UniProt: Q29PI5
LinkDB
Position
4
AA seq 953 aa
MLKATRKPTDPYKSKLKVNASNNSSVKPPLPIELSEEGNGSGSGSSSSPTTPQKLSLKGS
QLGGSILIGNYNYLTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMELIVNATNLQALLA
DHNCLHNISTTNTHPVPLKLHCIDISHNSFNELPNWIGACAALSTLDASHNRLTNITGLL
RNYRINQLVALNLSYNELQQLEYLPEGFGSIQKLQLQSNDLQCLPENFFAVTHSRLDTLN
AACNKLSTLPRYEQNNHAALVHLFLAGNQLNDSIFEALHNAARLKVLHLAYNRIGILPPA
CVRNWSELEILVLSGNMLQQLPEEVATLNHLKVLRCCNNLLLCTPQLAKLGKLKVLDLSH
NHLDRVNLLSLVPSRNLKYLDLSGNLQLQVDEQQFKVCQTQSERNWNLIDVSGNNRAALP
TSTLRLATAPRNQNKNSPWTMGFAETPGSGDCRKLLVCQLRAANYGGSDEALYGMFEAAD
GNGRVAQEMAQVVPDLMKQEQLVKDAPLRDYMKFTLLTAQQQCGSVRSAALFHLTRTRAP
SKVRPLKSKRYVLRMASTGRLDAYLVRRTTQLRLTDTESSAKDLGPSHAIPDPQVLELTL
SNDDEYLVVGNAQLWSVMDVGRAAREIRKEENALLAAKRLVDIAQSFGASENLSVIVVRF
RHLGTDVDHLIRELKQSVRKKPALVQPPTVSVCKRTCCDRSNACRHRALEQDPLAGRSSP
SGQSDRDLLSKDGPSVVPNDEFILAHARVMQEEQQLEMLDETESVLSEEQFKCWEYMLEQ
NTQLLFDKELNTISKSFTKQRAIPSTNLAMPDRNDFTTNLVRSVANKFISTSTPQLPQPL
ASTPTPIGSYHHIKPPMPGHFGSTLSFQQAQSCGYNMFDGKPRKMVGAPVKRGPHSAYFG
SLQRLMPYNFEYDFAVTHERERNILDEEEIDEDEFNEHESRMRKYWGVATTEL
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgctcaaagccacaaggaaaccgacggatccatacaagtcgaaactaaaagttaatgcc
agcaacaacagcagcgtcaaaccgccgctgcccatcgagctgtcggaggagggaaacggc
agcggcagcggcagcagcagcagcccgactactccgcagaagctcagcttgaagggcagc
cagctgggtggaagcattttgattggcaattacaactacttgacccaactggaggtgtgc
gaaaatgaaatggaggtcttggacctcagctcgctggcccaactggagacgctcaaatgc
agccggaacaagctaatggagctgatcgtaaacgccaccaatctgcaggcacttttagca
gaccacaactgccttcacaacatttccacaaccaacacccatccagtgccgttaaaactg
cattgcattgacatctcgcacaatagtttcaatgagctccccaattggattggggcctgt
gctgcgttgtccacactggatgcgtcgcacaatcgattgaccaacataacgggactgctt
cgaaactatagaatcaatcaattggttgctctgaatttgtcctacaatgaattgcagcag
cttgagtatttgcccgaaggctttggtagcatacaaaagctccaactccaaagcaacgac
ctccagtgtttgccggagaatttctttgctgtcactcattcacgcttggacaccttgaac
gccgcctgcaacaagctgtcgactctgccgcggtacgaacagaataatcatgcggccttg
gtgcacttgtttctggctggaaatcagctcaacgatagcatcttcgaggcactccacaac
gcagcccggctgaaggtgctccatcttgcctacaatcgcattggaatcctgcctcccgca
tgcgtacggaattggtcggagctggagatcctggttctatcgggcaacatgctgcaacaa
ctgcctgaggaggtggcgacgcttaatcacttgaaggtgctgcgatgctgcaacaatctc
ttgctctgcacgccacagctggccaagttgggaaagctgaaggtcctcgatttatcacac
aatcatctagatcgcgtcaatctgctgtccctcgtgccctcgcggaatctcaagtacttg
gatttgtcgggaaatttgcagctgcaggttgatgagcaacaattcaaggtatgccagacc
caaagtgagcgtaactggaacctaatcgatgtgtctggcaataaccgagctgccctgccc
accagtacgctgcgcctggcgacggcgccgcgaaatcaaaacaagaactccccctggaca
atgggcttcgcagagacgccaggatccggagactgccgaaagctgctggtctgccagttg
cgtgcggccaactatggcggctctgatgaggccctctatggcatgtttgaggccgcagat
ggcaatggacgggtggcacaggagatggctcaggtggtgccggatctaatgaagcaggag
cagctggtcaaggatgctcctctcagagattacatgaagttcacgttgctgacggcccag
cagcagtgcggaagtgtgcggagtgccgccttatttcatctcacccgaacacgggcaccc
tcaaaggtcaggcccttgaaaagcaagcgctatgtgctgcgcatggccagcactgggcgg
ctggatgcctatctggtgcgtcgaaccacacagttgcgcctgacagacacagaatccagc
gccaaggatctgggaccatcgcacgcaatacctgacccacaggttctagagctaacactg
agcaatgatgatgagtaccttgttgtgggcaatgcccagctctggtcggtcatggacgtt
ggtcgcgccgccagagagattcgcaaggaggaaaacgctttgctggcagccaagcggctt
gtggacattgcccagagcttcggtgcatcggagaacctcagtgtgattgtggtgcgcttc
cgtcatcttggaaccgacgtggatcatctcattcgggagctcaagcagagtgttcgcaaa
aagccagccctggtgcagccgcccactgtctccgtctgtaagcgtacctgctgtgatcgc
agcaacgcctgtcgtcaccgggcgctcgagcaggatccgctggccggacgctcctcgccg
agcggtcagagtgatcgtgatcttctgtccaaggacggcccgagcgttgtgcccaacgat
gagttcattctcgcgcatgcacgcgtgatgcaggaggagcagcagctggaaatgctggac
gaaacggaatctgtgctgtcggaggagcagttcaaatgctgggagtacatgctcgagcaa
aatacacagctgctatttgacaaggagcttaatactatttccaagtcatttaccaagcag
cgagccatcccgagcaccaatctagccatgccggatcgcaacgatttcaccaccaatcta
gtgcggagcgtggccaataagttcatctccacgagcacaccccagctgccacaaccactg
gcatccactcccacgccgattggctcctaccatcatattaagccgccgatgcccggccac
tttggcagcacgctctcattccaacaggcgcagagctgtggctataatatgttcgatgga
aaaccccgaaaaatggttggagcccccgtgaagcggggaccccactcggcttactttgga
tccctgcagcgattgatgccctacaactttgaatatgatttcgctgtcactcacgagcgg
gagcgtaatatattggacgaggaggagatcgatgaggatgagttcaacgaacacgagagc
cgtatgcgcaagtattggggcgtggcaacaacggaactttag

DBGET integrated database retrieval system