KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10423Help
Entry
Dpse_GA10423      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dpse_GA10423
Peptidases [BR:dpo01002]
 Metallo Peptidases
  Family M2
   Dpse_GA10423
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA10423
CD molecules [BR:dpo04090]
 Proteins
  Dpse_GA10423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 CHD5
Motif
Other DBs
NCBI-GeneID: 4811683
NCBI-ProteinID: XP_001352267
FlyBase: FBgn0070480
UniProt: Q29CJ8
LinkDB All DBs
Position
Unknown
AA seq 633 aa AA seqDB search
MEKIQIIWVLSLLLVFLARLPDGLATDNSCSVSTLDARRFFERENELLRQRYHEEYLASY
TYNTNVTDDNRQAMIAVYARNAVQNKQLAQKIKSSDYHLSEDADIRRQALHLSKMGASAL
NTEDYLALQNAISSMQSNYATTNVCSYTNRSDCSLTLEPHIQERLSNSRDPAELAWYWRE
WYDKAGTSQKDNFAEYVRLTRKAAHLNDHRSYADYWVQFYEDADFERQLDASFKQLLPFY
RQIHGYVRYRLRQHYGEDVVPAEGNIPMHLLGNMWAQSWNEVIDLFTPYPEKPFVDVKAE
MVQQNYTVQKLFELGDQFFQSLGMRALPPSFWNLSLITRPDDRQVVCHASAWDFYQDSDV
RIKMCTEVDMHYFFVVHHELGHIQYYLQYEQQPAVFRGAPNPGFHEAVGDVIALSVMSAK
HLKSIGLTDNGRLDEKSRINELFKQALSKIVFLPFGYTMDKYRYAVFRNEIEEPQWNCGF
WQMRSEYGGVEPPVSRTDKDFDPPAKYHIDADVEYLRYFAAHIFQFQFHKALCSLAGQYA
PNDSRRTLDNCDIFGSKEAGRALSKFLSHGSSRHWKEVLQEFTGETEMDTSALLEYFDPL
YQWLKQENSRLGVPLGWGETNKIPTDCCGQFST
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatacaaattatttgggttttgtcccttctgttggtctttctggcgcggctg
cctgacggtttggccacggacaattcatgttcagtctccaccttggatgcccgtcgtttc
tttgagcgtgaaaatgaattgctgcgccagcgctaccacgaggaatacctggctagctac
acctacaacaccaatgtgaccgatgacaatcgccaggctatgattgctgtctatgcacgt
aacgctgtacaaaacaaacagctggcccagaaaatcaaatcctccgactaccatctgtcc
gaggatgcagacatacgcaggcaggcactccacctgtccaagatgggagcatctgccctc
aatactgaggattatctggccctgcagaatgccatcagctcgatgcagtcgaattatgcc
acaaccaatgtgtgctcctatacgaaccgcagcgactgctcgctgacgctggagccgcat
attcaggagcgtctctcgaatagccgcgatccagcagagttggcctggtattggcgcgag
tggtacgacaaggcaggcacctcacagaaagacaactttgccgagtacgtgcgactcacc
cgcaaggcggcccatctaaatgatcatcgttcgtatgccgattactgggtgcagttctat
gaggatgccgactttgagagacaactggatgctagtttcaagcaactgcttcccttctac
aggcagatccacggctatgtcagataccgactgcgccagcattatggcgaggatgtggtc
cccgcagagggcaacatacccatgcatctgctgggcaacatgtgggctcagtcgtggaac
gaagtgattgatctcttcacaccctacccggagaaaccctttgtggatgtcaaggccgaa
atggtgcaacagaactacacggtccagaagctattcgagttgggcgaccagttctttcag
agtctgggcatgcgggcattgccgccgagcttctggaacctgagtttgattacccgcccc
gatgatcgtcaagtagtttgtcacgcctccgcctgggacttttatcaagacagcgatgtg
agaatcaaaatgtgcactgaggtggacatgcactacttctttgtggtccaccatgaactg
ggacacattcaatactacctgcagtatgaacagcagccggctgtcttcagaggagctccc
aatcccggctttcacgaggctgtgggcgatgtcatcgcgctgtcagtgatgtcggcgaag
catttgaaaagcattggcctgaccgacaatggccggctggacgagaagagtcgcatcaat
gagctgtttaagcaagccctctcgaagattgtgttcctgccctttggctataccatggat
aaatatcgatatgccgtcttccgcaacgaaatcgaggaaccgcaatggaactgcggcttc
tggcaaatgagatccgaatacggtggcgtcgagccgcccgtgtcgcgcacagacaaggac
tttgatccgccggccaagtatcacatcgatgcggatgtcgaatatctgcgctactttgcc
gcccacatatttcagttccagtttcacaaggccctctgcagcctggccggccagtatgcc
cccaacgacagtcggcgcaccctggacaattgcgacatatttggcagcaaggaggcgggt
cgtgcattgagcaaattcctgtcgcacggcagcagccgccactggaaggaagtcttgcag
gagtttacaggcgaaacggaaatggacacatccgccctcttggaatactttgatccgctt
tatcagtggctcaagcaagagaacagtcgactgggcgtacccttgggctggggcgagacg
aacaagatcccaaccgactgctgtggacagtttagcacttaa

DBGET integrated database retrieval system