KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11202Help
Entry
Dpse_GA11202      CDS       T01032                                 

Gene name
Dpse_Sod
Definition
(RefSeq) Sod
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04146  Peroxisome
dpo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dpse_GA11202 (Dpse_Sod)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dpse_GA11202 (Dpse_Sod)
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dpse_GA11202 (Dpse_Sod)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 4813641
NCBI-ProteinID: XP_001353944
FlyBase: FBgn0016313
UniProt: Q95086
LinkDB All DBs
Position
XR
AA seq 152 aa AA seqDB search
MVKAVCVINGDAKGTVFFEQETSEAPVKVTGEVLGLAKGLHGFHVHEFGDNTNGCMSSGP
HFNPRNKEHGAPTDENRHLGDLGNIQAAGDSPTAVSITDSKITLFGADSIIGRTVVVHAD
ADDLGKGGHELSKTTGNAGARIGCGVIGIAKI
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagctgtctgtgtaattaatggcgatgccaagggcaccgttttctttgagcag
gagaccagcgaggctcccgtgaaagtcaccggcgaggtgctgggccttgccaagggactg
cacggattccatgtgcacgagttcggggacaacaccaacggctgcatgtcgtccggcccc
cactttaacccccggaacaaggagcacggtgcccccaccgacgagaaccgccacttgggc
gacttgggcaacatccaggcagccggtgacagccccacggccgtcagcatcaccgactcg
aagatcacgctgttcggtgccgatagcatcataggacgcaccgtggtcgttcacgccgac
gctgatgacttgggcaagggtggtcacgagctaagcaagaccaccggcaatgccggcgcc
cgtattggctgcggtgtcattggcattgccaaaatctaa

DBGET integrated database retrieval system