KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA13464
Entry
Dpse_GA13464      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00230  Purine metabolism
dpo01100  Metabolic pathways
dpo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dpse_GA13464
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dpse_GA13464
Enzymes [BR:dpo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Dpse_GA13464
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 4817810
NCBI-ProteinID: XP_001357418
FlyBase: FBgn0073500
UniProt: A0A6I8W0N3 Q29P06
LinkDB
Position
4
AA seq 1194 aa
MPEEKEMSGNNLENGQAMATATATATANSTPSRSKHQRQKTPTRRRPHDSDVVAGGVGIT
GGGVVILPQHVLNELYHNYSIKQRRSGLKWFLFAAVLFNVWTICIPWDQAIPTRVVNCCM
LVAYLALTALMHIGRRSEQPSLRRFHLTFLTIMPRALWFLSVFHFAAYVMLQPSFSPRDV
LGWAILLNFLIYVTLPLPLIFLGLVIGFCTYFNCLSLPVGFSRPDPLISDQAAANAVLIA
TAALIGLLYYFMGEAKQKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMRED
LGSSSSEAFKKIYMSRHENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKY
QQLRIKILGDCYYCISGAPDERPDHAVMCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTG
AVLAGILGQRQWQFDVYSKDVELANKMESSGMAGRVHISDKTLAFLNGEFEVEPAFGEKR
EELLRIAGLKTFFITKVVKPFASPCARKINETQAESSQLSPNGSTTDVVSGGGEDNDATL
DDEELLAQSATTNGHQTAEAEDEEEQVKLENFKQRLKDELVTRDGHENLTKDTNIFLRFK
NPQLEQSYAVYREPYSSLPLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVV
ISIAESFSGMLPKFFVDVSKRFNDITFVRELAAIIIALTIGLSNVIDMFFFVTFVRTEHI
VSESEFNATAGLGLGLGLGLEADVDVDVAGAEAVTAEHLLPESFVEQMRDAVPTERVLYP
SYLSNFGVLILIAIAVIAQLTHLTKILLLLSIAALHCYFNIFIMQDLYALEDDLAHQPII
SSRYCASGLLLVAALALSTLARHMDHEDRVIFKWKTEVAEQKETANDMRQRNEALVYNVL
PVHVAEHFMKNTKRSHDDLYSQSYSEVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEV
ISDFDALLELPQFQDIIKIKTIGSTYMAASGINLQRNLRSDASITERWAQLAVLVEFALE
LTHTLQGINEQSFNHFVLKMGINHGPITAGVIGARKPHYDIWGNTVNVASRMESTGKAGA
IQVTEETCNILQKFGYTFQQRGLVSVKGKGQLMTYYLQGKSKHCAEPEATPAAIELHDTL
DSTTELDISDIKTPLLKLKGQEAPAAGESEQSGPAPSLGNGSVGQVGESQSLLE
NT seq 3585 nt   +upstreamnt  +downstreamnt
atgccggaggagaaggaaatgtccggaaataatctggaaaacggacaggccatggccacg
gctacggctacggccacggccaactcaacgccaagcaggtccaagcatcagcgccagaag
acgcccacaaggcggcgtccccatgatagtgatgtggtcgctggaggcgttggcatcacc
ggcggcggcgtggtcatcctgccgcagcatgtgctcaacgaactctatcacaactactcc
attaagcagcggcggagcggcctcaagtggttcctgttcgccgccgttctcttcaatgtc
tggaccatttgcataccctgggatcaggcaatacccacaagagttgtaaactgttgcatg
ctggtggcctatttggccctaacggccctgatgcacatcgggcgacgctcggagcagcct
tcactgagacgtttccatctaacattcctgacgattatgccgcgggctctttggttcctg
tccgtgttccactttgccgcctatgtgatgctgcagcccagcttctctccaagggatgtt
ctgggctgggccatcttgctaaacttcctgatctatgtgacgctgccgcttcctctgatt
ttccttggtctggtgattggcttctgcacgtacttcaattgcctgagcctccccgttggc
ttctctcgtcctgatcccctcatctcggatcaggcggcggccaatgcagttctgatagcc
accgccgccttgatcggtctactgtattactttatgggcgaggccaagcagaagcgagcc
tttttggaggccaaaaagagtctggaggtgaaaatggtcatcgaggaacagtccgccgaa
caggaacgtttactgttgtctgtgctgcccaagcatgtggctatcaaaatgcgcgaggac
ctgggctcatccagttcggaggcattcaaaaagatatacatgagtcgacacgagaatgtg
agcatactatatgcggatatagtgggctttaccgccatctcctcgacatatagcgctcaa
gacttggttaaaatgcttaacgagctcttcgcacgcttcgataggctcgccgagaaatat
caacaattgcgcattaagattctgggcgattgctattattgcattagcggtgcccccgac
gagcgaccggatcatgcggttatgtgtgtgcacatgggactctctatggtgaaggccatc
aagtatgtgcagcagaaggccaattcacctgttgatatgcgtgttggcatacacacgggc
gctgtgctggcagggatactcggccagcggcaatggcagtttgatgtctactccaaggac
gttgagctggctaataaaatggaatccagcggcatggcgggacgcgttcacatttcggac
aaaactttggccttcctcaacggggagtttgaggtggagcccgcctttggcgagaagcgg
gaggagctattgcgcatagccggattgaagaccttcttcataaccaaggtggttaagccg
tttgcatcgccctgtgccaggaaaatcaacgaaacgcaagccgaaagctcacaacttagc
cccaatggatccaccaccgatgtcgtttccggtgggggagaggacaacgatgccacgctg
gacgatgaggaactgctggcccagagtgccaccacgaatggccatcaaacagccgaggca
gaggatgaggaggaacaggtcaagttggagaactttaagcagcgcttgaaagacgagctc
gtcacccgagatgggcatgagaacctcaccaaggacaccaacatattcctgcgcttcaag
aacccacaattggagcaatcctatgccgtgtaccgagagccgtacagctccctgccgctg
ctggcggcactcctggtgcagtgcatcgacgttctatactcctacttggtgctgccccgc
tccacgctgcatttcatcaacatagcggcgccactggtgcccattgccatgctggtggtg
atcagcattgccgagagcttcagcggcatgctgcccaagttctttgtggacgtgagcaag
cgcttcaatgacattaccttcgtgcgggaactggcggccataattatcgccctcaccatt
ggcctgagcaatgtcatcgacatgttcttcttcgtcaccttcgtgcgcaccgagcacatt
gtgagcgaaagcgaattcaatgccacggctggtctgggtctgggactgggactgggtctg
gaggccgatgtggatgtggatgtggccggcgcggaggcggtcaccgccgagcacctgctg
cccgaatcgtttgtggagcaaatgcgcgatgcagtacccacagaacgtgtcctatatccg
tcctatttgagcaatttcggtgtcctaatattgattgcgattgccgtgattgctcagctc
acgcatctgactaaaatactcctattattgtccattgcggctctgcattgctacttcaac
atattcatcatgcaggacctgtatgccttggaggatgacctggcacatcagcccatcata
tcctcacgatactgtgcctctggtcttctgctggtggcagccctagctctgagcaccttg
gcccgacatatggatcacgaggatcgggtgatcttcaaatggaaaaccgaggtggcggaa
cagaaagagaccgccaacgatatgcggcagcgtaacgaggccttggtgtacaatgtttta
cccgttcatgttgctgaacatttcatgaagaataccaagcgatcacatgatgatctctac
tctcagagctattccgaggtgggagtattatttgccagcatgccaaacttttcagatttc
tattcggaggaaaccgtgaataatcagggtctggagtgtctacgttttctcaatgaagtt
atctctgattttgatgcgttattggaactgccacagttccaggatatcatcaaaatcaag
acgattggctcgacttatatggccgccagtggcataaatcttcagcggaatcttcgctcg
gatgcttccatcaccgaacgctgggcccagttggccgtgctcgtcgaattcgcattggaa
ctcacgcacactctgcaaggcattaacgagcagtccttcaatcactttgtcctcaagatg
ggcataaatcatggacccataaccgctggtgtgatcggtgctaggaagccgcactatgat
atctggggcaatacggtgaatgtggcatcccgcatggagagcactggcaaggccggcgcc
attcaggtcaccgaggaaacgtgcaacattctccagaagtttggctatacatttcagcaa
cgtggcctggtgtcggtcaagggcaagggtcaattgatgacctactatttgcagggcaaa
tctaagcattgtgcagagcctgaagccactccggcagccattgagctacatgatactctg
gattccaccacggagctggacatctcggacatcaagacgcccctgctcaagctgaagggc
caggaggcgccagcggcgggggagagtgaacagagtgggccggcgcccagtctgggcaat
ggcagtgtcggccaagtgggagaatctcaatctttattggaataa

DBGET integrated database retrieval system