KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18104
Entry
Dpse_GA18104      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20014  cell death protein rpr
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04214  Apoptosis - fly
dpo04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dpse_GA18104
   04215 Apoptosis - multiple species
    Dpse_GA18104
SSDB
Other DBs
NCBI-GeneID: 4813234
NCBI-ProteinID: XP_001353980
FlyBase: FBgn0078112
UniProt: Q2LYZ3
LinkDB
Position
XR
AA seq 72 aa
MAVAFYIPDQATLLRKAAQQEQELLRLRDSQWRFLATVVLETLRQFMDSAASQCLPRSGG
GRKCGKYRKPSQ
NT seq 219 nt   +upstreamnt  +downstreamnt
atggcagtggccttctacatacccgaccaggcgactctgctgcgcaaggcggcgcaacag
gagcaggagctgctgcgcctacgcgactcccagtggcgcttcctggccaccgtcgtcctc
gagaccctacgccagttcatggacagcgcggccagccagtgcctgccacggtccggtggc
ggccgcaagtgcggcaagtaccgcaagccctcgcagtaa

DBGET integrated database retrieval system