KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18123
Entry
Dpse_GA18123      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20018  cell death protein Grim
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04214  Apoptosis - fly
dpo04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dpse_GA18123
   04215 Apoptosis - multiple species
    Dpse_GA18123
SSDB
Other DBs
NCBI-GeneID: 4813236
NCBI-ProteinID: XP_001353979
FlyBase: FBgn0078131
UniProt: Q2LYZ4 A0A6I8UE45
LinkDB
Position
XR
AA seq 150 aa
MAIAYFIPDQAQLLARSNQQSAQQAAASTGAVPQQQQPGQQPGQQAGQQAPQPQTSQQRQ
QRPQFRANISVPLGRQQGAMSMSEFGCWDLLAQIFCYALRIYSYNSSQRRPTVIQISFEI
RSGGQEEQQQQEEDQEEHQADATDATGKGN
NT seq 453 nt   +upstreamnt  +downstreamnt
atggccattgcatatttcatacccgaccaggcccaactgctggccagaagcaatcagcaa
agtgctcaacaggccgccgcctcaacaggagccgtgccccagcagcagcagccaggacaa
cagccaggacaacaggcaggacaacaggcaccgcagccgcagacgagtcagcagcgacag
caacgtccccagttccgtgccaacatatccgtgcctctgggccggcagcagggagccatg
agcatgtccgagttcggctgctgggaccttctggcccagatcttctgctatgccctcaga
atctacagctacaactccagccagcgccggcccaccgtcattcagatctccttcgagatc
aggagtggcggccaggaggagcagcagcagcaggaggaggatcaggaggaacaccaggcg
gatgcgactgatgccacaggcaagggcaactga

DBGET integrated database retrieval system