KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18676
Entry
Dpse_GA18676      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20016  cell death protein hid
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04013  MAPK signaling pathway - fly
dpo04214  Apoptosis - fly
dpo04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dpse_GA18676
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dpse_GA18676
   04215 Apoptosis - multiple species
    Dpse_GA18676
SSDB
Motif
Pfam: DUF3915 Zip
Other DBs
NCBI-GeneID: 4813504
NCBI-ProteinID: XP_001353975
FlyBase: FBgn0078676
UniProt: Q2LYZ8
LinkDB
Position
XR
AA seq 405 aa
MAVPFYLPEGGADDIASSGASGSSSGASSSGASTSSAGSSDGASSIASQSPNTTTSATQT
PMQSPLPTEQVLYALCQWVRHYHSQTQQNAAQIFQYPPPPSPSCNYTVGDVFFPHGPPPV
PPRTPRTSVSFAAGEEYNFFRQQTQPPYPAPSTPQPMPPQPPQSAPPMHYSHSFPQQSPH
LLQHHHPASVYGMGQHQPGPGSYYATYTPPPTPNTANAGTSTSSAAFGWHSHGPQLASTP
LTAPMGSKMRLQRSQSDAARRKRLTSTGEDEREYQSDHETSWDDEYDDRYDNFTAGRERL
QEFNGRIPPRKKKNSHSSSSSHSHSHSNNNPISQNNFQLHSSNAECSSSASGSASHGSNS
QREREREREREQRAEAEKKKPQVFTWPTVVTVFVLAMGCGFFAAR
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggccgtgcccttttatctgcccgagggcggagccgatgacatcgcctcgtcgggcgcc
tcgggctcctcttcgggcgcatcgtcgtcgggtgcctccacctcgtcggcaggctcctcg
gacggcgccagcagcattgcctcccagtcccccaacaccaccacatcggccacgcagacg
ccgatgcagtccccactgcccacggagcaggtgctctacgccctctgccagtgggtgcgc
cactatcacagccaaacccaacagaacgccgcgcagatcttccagtacccgccgccgccg
agtccctcatgcaactatacggtcggcgatgtcttcttcccccacggcccaccgccagtg
ccgccgcggacaccgcgcaccagcgtcagctttgccgccggcgaggagtacaacttcttc
cggcagcagacacagccgccgtatccggcgccgtccacgccgcagccaatgccaccgcag
ccgccgcagtcggcgccaccgatgcactacagccacagcttcccgcagcagtcgccgcac
ttgctgcagcaccaccatcccgcctccgtctatggcatggggcagcaccagccgggtccc
ggctcctactacgccacctacacaccgccccccacaccgaacacggccaatgccggcacc
tcgacctcatcggcggcctttgggtggcacagccatggcccccagctggcatcgacaccg
ctgacggcgccaatgggctccaagatgcggctgcagcgcagccagtcggatgcagccaga
cgcaagcgattgacctcgacgggcgaggatgagcgcgagtatcagagcgatcatgagacc
agctgggatgatgagtacgatgatcgttatgacaattttacggccggacgggagcgtctg
caggagttcaacggacggataccaccacggaagaagaagaacagtcacagcagcagcagc
agccacagccacagccacagcaacaacaatccaatcagccaaaataatttccaactccat
tcatcgaatgccgagtgcagcagcagcgccagcggcagtgccagccacggcagcaacagt
cagagagagcgagagcgggagcgggagcgggagcagcgagcggaggccgagaagaagaaa
ccgcaggtcttcacctggccgaccgttgtgaccgtgttcgtgctggccatgggatgcggc
ttctttgcggcgcgatga

DBGET integrated database retrieval system