KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18828
Entry
Dpse_GA18828      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04214  Apoptosis - fly
dpo04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dpse_GA18828
   04215 Apoptosis - multiple species
    Dpse_GA18828
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpo01002]
    Dpse_GA18828
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     Dpse_GA18828
Peptidases and inhibitors [BR:dpo01002]
 Cysteine peptidases
  Family C14: caspase family
   Dpse_GA18828
SSDB
Motif
Pfam: Peptidase_C14 DUF4347
Other DBs
NCBI-GeneID: 4804550
NCBI-ProteinID: XP_001361093
FlyBase: FBgn0078828
UniProt: A0A6I8UUH5
LinkDB
Position
3
AA seq 323 aa
MTDECITRNFIALGSNGTCVNRSSIGDSTDAKGCEGNNAGVGGATAAASIPPPSINNYVA
RMPVERYASEYNMNHKHRGQAIIFNHEFFEIPTLRARMGTNVDAEELRKTFKRLGFDVSV
HKDCKWQNIREQIEKAAALDHTDSDCLAIAILSHGEHGCIYANDVQYKLDQIWHYFTAKM
CPTLAGKPKLFFIQACQGDGLDEGVMLEKGVTETDGDSSMGYKIPVHADFLFSYSTIPGY
YSWRNINNGSWYMQSLIQELNSNAKKYDLLTLLTFVSQRVAIDFESNVPATPMMDRQKQI
PCFTSMLTRILRFGDKPNGNKAG
NT seq 972 nt   +upstreamnt  +downstreamnt
atgactgacgagtgcataactaggaactttattgctctcggttcaaatggaacgtgtgtc
aatcgcagcagcattggtgatagtaccgatgccaaaggctgtgagggcaacaacgccgga
gttggtggtgcaacggctgcagcgagtattcctcccccctcgatcaacaattatgtggca
cgaatgcccgttgagcggtatgccagcgagtacaacatgaatcacaaacatcgcggtcag
gccattatattcaatcatgagttcttcgagatacctacgctgagggcgcgtatgggtacc
aatgtggatgcggaggagctgcgcaagacctttaagagattgggtttcgatgtgtcagtg
cacaaggactgcaaatggcagaacatacgcgaacagatcgagaaggccgccgcgctggac
catacggacagcgactgcctggccattgccatcttgtcgcatggcgagcatggctgcatt
tatgccaacgatgttcagtacaagctggaccaaatctggcactacttcactgccaagatg
tgccccacgctggcgggcaagccgaagttgttcttcatacaggcctgccagggagatggc
ctggacgagggcgtgatgctagagaagggagtgactgaaacggatggggactcgtctatg
ggctacaaaatacccgtccatgccgactttctcttctcctactcgacgataccaggctac
tattcctggcgcaatataaacaacggctcgtggtacatgcagtcactcatccaggagctg
aatagcaatgccaagaaatacgacctgctcacgctgctcacttttgtcagtcagcgcgta
gccatcgactttgagtcgaacgtgccggctaccccaatgatggatcgccagaaacagata
ccgtgcttcacctcgatgctgacgcgcatactgcgcttcggcgacaaacccaacggcaat
aaggctggctga

DBGET integrated database retrieval system