KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18999Help
Entry
Dpse_GA18999      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo03030  DNA replication
dpo03410  Base excision repair
dpo03420  Nucleotide excision repair
dpo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Dpse_GA18999
   03410 Base excision repair
    Dpse_GA18999
   03420 Nucleotide excision repair
    Dpse_GA18999
   03430 Mismatch repair
    Dpse_GA18999
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dpo03032]
    Dpse_GA18999
   03400 DNA repair and recombination proteins [BR:dpo03400]
    Dpse_GA18999
Enzymes [BR:dpo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dpse_GA18999
    6.5.1.6  DNA ligase (ATP or NAD+)
     Dpse_GA18999
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Dpse_GA18999
DNA replication proteins [BR:dpo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Dpse_GA18999
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Dpse_GA18999
DNA repair and recombination proteins [BR:dpo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Dpse_GA18999
   NER (nucleotide excision repair)
    Other NER factors
     Dpse_GA18999
   MMR (mismatch exicision repair)
    Other MMR factors
     Dpse_GA18999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme Orthopox_A49R
Motif
Other DBs
NCBI-GeneID: 4803515
NCBI-ProteinID: XP_001360228
FlyBase: FBgn0078997
UniProt: Q292Q9
LinkDB All DBs
Position
3
AA seq 744 aa AA seqDB search
MQQSITSYFKQKSDVPESPGKARPVSKIKSEIDLAENEPKIKSEDETSEANIEANRIIDP
NPSTIEAMEIKEEPTSKVERKVTTIGLNSTSKDNKEEVENYDPSNEAYHPLEHAYWKAKA
VTPYLALARTFQVIEETKGRLKMIDTLSNFFSSVMLVSPNDLLPSVYLSINQLAPAYEGL
ELGVAETTLMKAICKATGRNLAHIKSQTHLTGDLGIVAEQSRVSQRMMFQPAPLNIRGVF
SKLREIAKISGQSKMTLVYDVFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAIALVK
KNHINDCKVSKIVDVYKDEITETTLLLKTAYSQCPNYDIIIPAILKYDIKELQERCPMHP
GMPLRPMLAQPTKGVHEVFERFGSMHITCEWKYDGERAQIHCNERGEISIFSRNSENNTA
KYPDLIARSKGFLKGAVQSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQVC
VYIFDLLYINGTTLVTSPLSERRKLLLEHFQEVEGEWKFATALDTNDMDEVQQFLEESVK
GNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYG
GFLLACYDTENEEYQSICKIGTGFTDEDLRIHSEFLGKHVIPSAKSYFRYDSSLEPDHWF
EPAQVWEVKCADLSLSPIHRAAIGIVDTERGISLRFPRFIRIRDDKSSENATDANQVAHM
YQSQDQVKNNQRTCTQMDMESEFY
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagtccataacatcctattttaagcaaaaatccgatgtgccggagagccctggc
aaagccagaccagtttcgaaaattaagtcggagattgatttggctgaaaatgaacccaaa
atcaagagtgaagatgagacctctgaagctaatattgaagcaaaccgtattattgatcca
aatccgagcacaattgaagctatggaaatcaaggaggagccgacaagcaaagttgaacgg
aaagtaacaacaattggactgaactccacatctaaagataacaaagaggaagtggaaaac
tacgatccctcaaacgaagcctatcatcccctggagcacgcatactggaaggccaaagcg
gtgacaccgtatttggcgttagctcgaacgtttcaagtgatagaggagaccaaaggccgc
ctcaagatgattgatacgttaagcaattttttttcctcggttatgttagttagcccaaat
gacttgctgcccagtgtttatctcagtattaaccagctggcccccgcctacgaggggctg
gaacttggtgtggctgagacaacgttaatgaaggcaatctgcaaggcgacgggccgtaac
ttggcacacatcaaatctcaaacgcacttaaccggcgacctgggcattgtcgccgagcag
tcgcgcgtttcgcaacgcatgatgtttcagcctgctccactgaacatcagaggagtattc
agcaagctaagagaaatagccaagatatctggtcagtccaagatgactctcgtctatgat
gtctttgtggcctgtcgatcatctgaggctcgtttctttatacgctccctgatcggcaag
ttgcgcattggcatcgcagagcaaagtcttctcactgctcttgcaattgctttggtgaag
aaaaatcacattaacgactgcaaggtcagcaaaatagtcgacgtttacaaagatgaaata
acggagactacgttattgctgaaaacagcatatagccaatgccccaactacgacattatt
attcctgcaatattgaagtatgacatcaaggagctccaagaacgttgccccatgcaccca
ggcatgccgctgaggccaatgctcgcacaaccaacaaaaggagttcatgaggtgtttgag
cgctttggaagcatgcacataacgtgcgaatggaaatacgacggcgaacgagcccagatt
cactgcaacgagcggggagagataagcatattctctcgcaactcggagaacaacacggcg
aagtatccggatttgattgccaggagcaaaggtttccttaagggtgcagtgcagtcttac
attattgatagcgaaatcgttgcctgggacgttgagcgaaagcagattctgccattccaa
gtactcagtacgcgcaaaagaaaaaacgtggacatagaagagatcaaagttcaagtctgt
gtttacatattcgatcttctgtatattaatggtacgacccttgtcacaagtccattatcc
gagcgccgcaagctgctgctagaacatttccaggaagtcgaaggtgaatggaaattcgcc
acagctctggacactaacgatatggatgaggtgcagcaatttttagaggaatcagttaaa
ggcaattgtgagggactcatggtcaagacattggatgaggaagccacgtatgaaatcgca
aaaagatcaaggaattggcttaagttgaaaaaggattatttgtcaaatgtgggcgactcg
cttgatcttgttgtaattggcggctacaaaggaaagggacgacgaaccgggacctatggc
ggatttctgcttgcctgctatgacaccgaaaacgaggaataccagagcatctgcaaaatt
gggacagggttcactgatgaagatttgcggatacactctgaattcttaggcaaacatgtc
atacccagtgccaagtcatactttagatatgactcaagcctggaaccggaccactggttt
gagccggctcaggtttgggaagtaaagtgcgcagacctctcccttagccccatccataga
gcagccataggcatcgttgacaccgagcggggtatttcgctgcgattcccccgattcatt
cgaattcgagatgataagagcagcgaaaacgcaacagatgccaatcaagtagcccacatg
taccagtcgcaggatcaggttaagaataatcagaggacttgtacacagatggatatggag
agcgagttctactga

DBGET integrated database retrieval system