KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19047Help
Entry
Dpse_GA19047      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform E
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00562  Inositol phosphate metabolism
dpo01100  Metabolic pathways
dpo04068  FoxO signaling pathway
dpo04070  Phosphatidylinositol signaling system
dpo04140  Autophagy - animal
dpo04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dpse_GA19047
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    Dpse_GA19047
   04070 Phosphatidylinositol signaling system
    Dpse_GA19047
   04150 mTOR signaling pathway
    Dpse_GA19047
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dpse_GA19047
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpo01009]
    Dpse_GA19047
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dpse_GA19047
    3.1.3.48  protein-tyrosine-phosphatase
     Dpse_GA19047
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     Dpse_GA19047
Protein phosphatases and associated proteins [BR:dpo01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    Dpse_GA19047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 DSPn
Motif
Other DBs
NCBI-GeneID: 4811838
NCBI-ProteinID: XP_001382218
FlyBase: FBgn0079045
UniProt: Q29CW7
LinkDB All DBs
Position
Unknown
AA seq 468 aa AA seqDB search
MANTISLMSNVIRNVVSKNRIRYKGERFDLDLTYIYDNIIAMGYPSPDKLERMYRNCQED
VLKFLDEKHGDHYKIYNLCLERIYDSNKFHGRVAIFPFEDHNPPTIELIQKFCKDVDSWL
KEDVLNVVAVHCKAGKGRTGTMICAYLLYSGLQKSADEALAWYDEKRTKDGKGVTIPSQR
RYVQYFSNLVCSSVPYSKKMFKVCEIRFSESSLLKNLGTVKCKVFVLQDSTTENVKEHSS
KKWTVDFQESCVLNINPSLSVAGDIKFEFEQKSSEKVIFHFWLNTFFVQNSSVCESDGTL
LKCTYTLKKSEIDGVHKDRKHKSFSEDFKISILFEGEACFNDETKSKKQPKAALENQDIS
TKIQYDTTTNLKNVSTASKRKQPNNIPLASNLNNDSTGMDLKKIHTFKPPSITKSNLTTW
ENGEINITSDTRSINDNKHINYDSYITYKQSSPKDGEEDWESGESTRL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacacaatatcgttaatgtccaatgtgatacgcaatgtagtgagcaaaaatcgt
attcggtacaaaggagagcgattcgacttggatcttacatacatttacgacaatataatt
gccatggggtatccttcgccagataaactggagcgcatgtacagaaattgtcaagaagat
gttctcaaatttttggatgaaaagcatggagatcattataaaatttataatctatgtctt
gaacgcatttatgactccaataaatttcatgggagagttgcaatttttccgttcgaagat
cataatcctccaacgattgaattgatacaaaaattttgtaaagatgtggattcttggctc
aaggaagatgtattaaatgtcgttgccgtacattgtaaagctggaaaaggaagaacaggt
accatgatttgtgcatatttactgtacagtggcttacagaaatccgctgatgaggccttg
gcctggtatgatgaaaaacgtacaaaggatggtaaaggtgtcacaatcccatctcagcga
cgatatgttcagtatttttcaaacctagtttgttctagtgttccatattcaaaaaaaatg
tttaaagtctgtgaaatacggttttcggagtccagtttgctgaaaaacctagggacggta
aaatgtaaagtatttgtactacaggactctacaacagaaaatgtaaaagaacatagttcg
aaaaagtggactgttgattttcaagaatcttgtgtgttgaatataaatccatctctatcg
gttgccggtgatataaaatttgaatttgaacaaaagtcttcagagaaagtaattttccat
ttttggctaaatacattcttcgttcaaaattcttcagtttgcgaatccgacggaaccctt
ttaaaatgtacatacacattaaaaaaatcagaaatcgatggtgttcataaagaccgcaaa
cacaaatcgttttcagaagacttcaagatttccatattatttgagggagaagcgtgtttc
aatgatgaaacgaaatcgaaaaagcaaccaaaagccgcattggaaaaccaggatatatcg
actaaaattcaatacgacacaacaaccaatttaaaaaatgtctcgactgcgtcaaaacgc
aaacagcccaataacatacctcttgcatcaaacttaaataatgattccacaggaatggat
ttaaaaaaaatacatactttcaaaccaccgtccattacaaaaagtaacttaaccacttgg
gagaatggtgaaattaatatcacctctgatactcgaagtataaatgataataaacacatc
aattatgattcatacatcacatataagcaatcttctccaaaagatggagaggaagattgg
gaatctggtgaatcaacacgcctgtaa

DBGET integrated database retrieval system