KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19081Help
Entry
Dpse_GA19081      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00020  Citrate cycle (TCA cycle)
dpo00190  Oxidative phosphorylation
dpo01100  Metabolic pathways
dpo01200  Carbon metabolism
Module
dpo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dpo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dpse_GA19081
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dpse_GA19081
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dpse_GA19081
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 4813894
NCBI-ProteinID: XP_001353277
FlyBase: FBgn0079079
UniProt: Q2M0Z6
LinkDB All DBs
Position
XR
AA seq 693 aa AA seqDB search
MFIQKYQAGFYSFYRFSSGRTPCFCNQTCREQINWKKSVYSTISTMRLLSVALLKRSTTG
LWSIDVRRLHGTAAMRACKEDYAMTDHKYDAIVIGAGGAGMRAGFGLAEKGFKTALISKL
FPTRSHTVAAQGGVNAALSNMDKDDWKYHFYDTVKGSDWLGDQNAIHYMCREAENAVYEL
DQFGMPFSRKQDGKIYQRPFGGQTLGYGKGGVARRACAVADRTGHALIHTLYGQTLKYAD
LCHYFIDYFVLDLIMVKGRCAGCLAWKLDDGTMHRFIANNTVVAAGGCGRVYFSTTAGHT
CTGDGNAWISRQKLPLQDMEFVQFHPTGMYGAGCLITEGVRGEGGFFLNSKGERFMERYA
PTAKDLASRDVVARAMTMEVLAGNGCGPLKDHVHLQLHHIDPKIIHERLPGIVVTAKIFA
KVDVTKEPVPVLPTVHYNMGGIPTDFMGRVVTVDQECQEQAIEGLYACGETSCASVHGAN
RLGANSLLDLIVFGRSCALAIASNNCPGETPPDVDEKATAETLDNFKKLRCADGKTTTAA
IRMELQRTMTGHAAVFREGKLLKKGLLKVADLCQQFKSVKVVDRSMVWNTDLVETLELQN
MLANAVHIITAMENRKESRGSHSREDFKVRLDEFDYSKPLEGQKKKKLEEHWRKHTLTFA
QGDEGCATIKYREVIDNTLDDTLAPIPPAPRTY
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgtttatccaaaagtatcaggcaggattttatagtttttataggttttcctcaggtagg
actccctgcttttgcaatcaaacttgtagagaacaaatcaactggaagaaatcagtttat
tcaacgatctctacaatgcgtctcctttccgttgctctcttgaagcgctccactaccgga
ctctggtccatcgacgtacgccgccttcatggaactgctgcgatgcgcgcctgcaaggag
gactacgccatgaccgaccacaagtatgatgccatcgtgatcggagctggtggggccggg
atgcgtgctggctttgggctggccgagaagggcttcaagacggcactgatctcgaagctg
ttccccacccgctcccacacggtggccgcccagggtggggtgaatgcggccctgagcaac
atggacaaggacgattggaagtaccacttctacgacacggtcaagggcagcgactggctg
ggcgaccagaacgccatccactacatgtgccgcgaggcggagaatgcagtctacgagctc
gaccagttcgggatgcccttctcccgcaagcaggatgggaagatctaccagcgtcccttc
gggggccagaccctgggctatggaaagggcggtgtggcgcgtcgcgcctgtgctgtggcc
gatcgcactggccacgccctcatccacacgctctacgggcagacgcttaagtatgccgat
ctgtgccactacttcatcgactatttcgtgttggacctgatcatggtaaagggtcgctgc
gctggctgccttgcctggaagctggacgacggaaccatgcatcgcttcattgccaacaac
acggtggtagcggccggcggctgtggtcgcgtgtacttctcgacaacagcgggacacacc
tgtaccggcgacggcaacgcctggatatcgcgccagaagctgcctcttcaggacatggaa
ttcgtgcagttccatcctacaggcatgtacggcgctggctgcctcatcacagagggtgtg
cgtggcgagggcggtttcttcttgaattccaagggggagcgcttcatggaacgctatgcc
cccaccgcaaaggatctcgcctcccgggacgtggtggcacgcgcaatgaccatggaggtg
ctggccggcaatggctgcggtccgctgaaggatcacgtgcacttgcagctgcaccatatc
gatcccaagatcatacacgagcgtctgccaggcattgtggtcacagccaagatattcgct
aaagtggatgtgaccaaggagccggtgccggtgctgccaaccgtacactacaacatgggc
ggcattcccacggactttatgggtcgcgtggtgactgtcgaccaggaatgccaggagcag
gccatcgagggcctctacgcctgtggcgagacatcgtgcgcctcggtccatggcgccaac
cgattgggcgccaactcgctgctggatctgattgtgtttgggcgctcgtgcgccctggcc
atcgcctccaacaattgcccgggcgagacgcctccggacgtcgacgagaaggccaccgcg
gagactctggacaacttcaagaagcttcgctgtgccgacggcaagactactacggctgcg
atccgaatggagctgcagcgcacgatgaccggacacgcggccgtcttccgcgaggggaag
ctgctcaagaagggcctgttgaaggtggccgatctgtgccagcaattcaagagcgtgaag
gtggtggaccgcagcatggtgtggaacacggacctggtcgagaccctcgagttgcagaac
atgttggccaatgcggtgcacatcatcaccgccatggagaaccgcaaggagtcgcgcggg
tcccattcccgcgaggatttcaaggttcgcttggacgagtttgactactccaagcccttg
gaggggcagaagaagaagaaactggaggaacactggcgcaagcataccctaaccttcgcc
cagggtgacgagggatgcgccaccattaagtaccgcgaggtcatcgacaacaccctcgac
gacacgctcgccccgatcccaccggctccacgcacctactag

DBGET integrated database retrieval system