KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19406Help
Entry
Dpse_GA19406      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpo01009]
    Dpse_GA19406
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dpo03019]
    Dpse_GA19406
   04131 Membrane trafficking [BR:dpo04131]
    Dpse_GA19406
   03036 Chromosome and associated proteins [BR:dpo03036]
    Dpse_GA19406
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dpse_GA19406
Protein phosphatases and associated proteins [BR:dpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dpse_GA19406
Messenger RNA biogenesis [BR:dpo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Dpse_GA19406
Membrane trafficking [BR:dpo04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    Dpse_GA19406
Chromosome and associated proteins [BR:dpo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Dpse_GA19406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 4814791
NCBI-ProteinID: XP_001355195
FlyBase: FBgn0079403
UniProt: Q29G58
LinkDB All DBs
Position
XL
AA seq 1146 aa AA seqDB search
MAMKSGSNSTAAAASSSTSGAIKSSSVGAELPKRSETLLEAKRRARNMLKNQGNTPAMQE
TVTDIFQTAVKSRPLVRGETALVYHQSMEQHCCRWDPKHLECPDRFNRVLDRCNELKLLD
RCLPVSARLATKQEILRLHTAQHFELLEQTSEVCDDQSMEELSSRFDSIYIHPSTFQCSL
LASGSTIDLVDSIITGKAQNGMAIIRPPGHHAMKAEFNGYCFFNNVALAAQHALDVHKLE
RILILDYDVHHGQGTQRFFYNDPRVLYFSIHRFEHGAFWPHLQESDYHAIGEGPGLGFNF
NVPLNETGMGDGDYMAIFQQLLLPVAMEYQPELIIVSAGYDAALGCPEGEMQVTPAFYAH
LLNPLLRLADSRVAVVLEGGYCLESLAEGAALTMRTLLGDPCPMLVEPLLPPKRSMSKSI
LNCIFAHRPYWRCLQLQGTYDPSELKTKDRSRELHVVERAWVGGPPPVTVYPTRDTSVQH
LIPEAVVADNTARLHRLRLETILTVPAVRVCYAYNPEMMEHRNLDDLGHPEQPKRIQFIH
KMHQDYQLLGRMKQLSARAATTDEICLAHSRSHVNTMRRVLGRDKEDLQAQAATYNSVYL
HPATFGCATLAAGSVLQAVDSVLRGESRSAICNVRPPGHHAEPDQPHGFCIFNNVAIAAQ
YAIREFGLKRVLILDWDVHHGNGTQHIFESNPKVLYISVHRYENGTFFPKGPDGNYDVVG
KHTGAGFNVNIPWNKKGMGDLEYALAFQQIVMPIAYEFQPELVLVSAGFDAAIGDPLGGC
KVSPEGYGLFTHWLSALAGGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPLLGVVA
LTRPPTTAFQSCLETLQCCVEVQRQYWKSLEFVGYRLPHGYQIGENNNEDFLAASLLKLN
ISSDDAQGAAGGPTDGDQADPGQERPSDSKPKVKVKPPNHSTAAPEEMFAIPPSKTCPHM
RMLRPELVPQSINTRAPCGECISRSENWMCLSCHYIGCGRYVGRHMQRHCEALEHTLVMR
LQDHAVWCYVCGVYLDNPRLFEYKNRAHQDKYGRPLAWRYPCAKRADGCYPLDPESDSEE
EADHIANGSYLQEAQXPLLLRVLHALTDYMCTLCPPFRHILQFLVEHMWPLLERTYLKLI
QFFLGN
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atggctatgaagtcgggttcgaattcgactgcggctgcggcatcgtcgtcaacgtcgggg
gcgatcaaaagcagcagcgtcggcgccgagctgcccaaacggagcgaaaccctcttggag
gcaaaacgtcgcgctcgaaacatgctcaagaaccaaggcaatacaccagccatgcaggaa
actgtgacggatatattccagacagctgtcaagtcgcggcctctggtgcgcggagaaacg
gctctggtctaccatcagtcgatggagcagcattgctgccgctgggatccaaagcacttg
gagtgtcccgatcggtttaatcgcgttttggatcgctgcaacgagctgaagctattggat
cgctgcctgccagtgtccgccaggctggccaccaaacaggagatactccggctgcacacg
gcccagcattttgaactgttggagcagacgtccgaggtgtgcgacgaccagagcatggag
gagcttagctctcgctttgattcaatatacatacatccgtccacttttcagtgctccttg
cttgccagcggatccaccattgatctggtggattccataattacgggcaaggcgcagaat
ggcatggccatcatccgaccgccaggccatcatgccatgaaggccgaattcaatggctat
tgtttcttcaacaatgtggccctggccgctcagcatgccctcgacgtgcacaagctggag
cgcatcctgatccttgactacgatgtccatcatggtcagggcacacagcgcttcttctac
aacgatcccagggtgctgtatttctccatacatcgcttcgagcacggcgccttctggcca
catctgcaggagtccgactaccatgccattggcgagggccctggcctgggtttcaacttc
aatgtgccgctcaatgagacaggaatgggcgacggggactacatggccatcttccagcag
ctgctactgcccgtggcaatggagtaccagccagagctgattatcgtctcggccggctat
gatgcggccctgggctgtcccgagggtgaaatgcaggtgacgcccgccttctatgcgcat
ctgctcaatccgctgctccgactggccgactcccgtgtggccgtcgtgctcgaaggaggc
tactgccttgaatctctggccgagggagcggccctcacgatgcgcaccctgctgggtgat
ccctgcccaatgctggtcgagccgctgctcccgccgaagcgttcgatgtccaaatccatt
ctcaactgcatatttgctcaccggccgtactggcgttgcctgcagctgcagggtacctac
gatccatcagagctgaagaccaaggatcggagtcgggagttgcatgttgtagaacgtgca
tgggttggcggaccgccacccgtcaccgtttatccgacgcgggacacctccgtgcaacac
ctcattcccgaagcggtagtggccgataacacggcccgattgcaccgactgcggctggag
accattctgacggttcctgcagttcgtgtgtgctacgcttacaatcccgagatgatggaa
caccgcaacctggacgacctgggccatccggaacagccgaagcgcatccagttcatacac
aaaatgcaccaggattatcagctgctcggccgcatgaagcagctgtctgcgcgggcggcc
accaccgacgagatctgtctggcgcacagtcgctcccacgtaaacacaatgcggcgagtg
ctgggccgagacaaagaggatctccaggcgcaggcagcgacctacaattcggtgtacttg
catccggccacgtttggttgcgccaccctggccgctggatccgttctccaggcggtagac
agtgtgctccgcggggagtcccgcagtgcgatctgcaatgtccgtccgcctggccaccat
gcggagccggaccagccgcacggtttctgcatcttcaacaatgttgccattgccgcccag
tacgccatccgggagtttggcctgaagcgagtgctaatcctcgactgggatgtccaccac
ggtaatggcacccagcacatcttcgagtcaaatccgaaggtactgtacatcagcgtccac
cgctacgagaacggaacgttcttccccaagggccccgacggcaactacgatgtggtgggc
aagcatacgggagccggctttaatgtcaatataccgtggaataagaagggcatgggggat
ctggagtacgctttggccttccagcagatcgtaatgccaattgcgtacgagttccagccg
gaactggtgctcgtgtcggcgggcttcgatgcggccatcggggatcctctagggggctgc
aaagtctcgcccgagggctacggtctgttcacccactggctgtctgccctggccggtggc
cggataattgtgtgcctcgaaggaggctacaatgtcaactccatttcgtatgcgatgacc
atgtgcacaaagacgctgttgggggatccggtgccgacgccactgctgggtgtggttgcc
ctgacaaggccgccgaccacggccttccagagctgcctggagacgctacagtgctgcgtg
gaggtgcagcgtcagtattggaagtcgctggagtttgttggctaccggctgccgcatggc
taccagattggggagaacaacaacgaggattttcttgccgcttccttgctgaagttgaat
atttcaagtgacgatgcccagggcgcggcgggcggccccaccgacggcgatcaggccgat
ccagggcaggaacggcccagcgacagcaagcccaaagtcaaggtaaagccgcccaatcat
tcaacggccgcgccagaggagatgtttgccattcccccgagcaagacttgtccgcacatg
agaatgctacgaccggagctggtgccgcaatcaataaacacaagggcgccgtgcggcgag
tgcatctctaggtcggagaactggatgtgtttgagctgtcattatattggctgtggacgc
tacgtgggccggcacatgcagaggcactgcgaggctctcgaacacacactggtgatgcgc
ttgcaggaccatgccgtgtggtgctatgtgtgcggcgtttacctcgataatccgcgacta
ttcgaatacaagaatcgggcgcatcaggacaaatacggcagaccgctggcctggcgctat
ccctgtgcgaagcgtgccgatggctgttatccgttggatcccgaatcggattcggaggag
gaggccgatcatattgccaacgggagctatctccaggaggcccagtgacccttgctgcta
cgcgtcctgcacgccctcacagattatatgtgcacgttgtgcccaccattcagacacata
ctccagttcctggtcgagcacatgtggccgctgctggaacgcacttaccttaagcttata
caattttttttgggcaattaa

DBGET integrated database retrieval system