KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20921
Entry
Dpse_GA20921      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K20017  Bcl-2 family protein
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04214  Apoptosis - fly
dpo04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dpse_GA20921
   04215 Apoptosis - multiple species
    Dpse_GA20921
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 4805401
NCBI-ProteinID: XP_001361806
FlyBase: FBgn0080910
UniProt: A0A6I8UW99
LinkDB
Position
3
AA seq 290 aa
MRSTSSDNHGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEVGQRETTRRRLSNVSDV
VTRKLSYTIGWKAAQIPAQDIITQGRCLCGHYIKRRLRRSGLFNKKLGLQRIRSILGSTS
MGIVRDVFPAVQVLGDELERMHPRAYNGVARQICRNPGGEFHTPDAVSLLLGAVGRDLFR
ADITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINENGGWSGIN
THVLPTTNSLNPLEWTTLVIGVVFGLILLFMFLRFIVSTIIPKIYQRFTN
NT seq 873 nt   +upstreamnt  +downstreamnt
atgcgatccacttccagcgataaccacggcttccccatggccaccacacagagcgaacgc
ctgctgcaggcccagaatcggcgcaagttcagcttcccggccacgctccactccgcctcg
ctgctggaggtggggcaacgcgagacgacccggcggcgcctcagcaatgtcagcgacgtt
gtcaccaggaaactctcctacaccattggctggaaggcggcacagattcccgcccaggac
atcataacgcagggccgctgtctgtgcgggcactacatcaagcgacgcctgagacgatcg
ggtttgttcaacaagaagttgggcctgcagcgaatacggagtatcctgggctccacctcc
atgggcattgtgcgggatgtctttccagcggttcaggtgcttggcgacgaactggaacgg
atgcatccacgtgcctataacggcgtcgcccgtcagatttgtcgcaatcctgggggcgag
ttccacacacccgatgctgtcagcctgctcctaggggcagtgggtcgggatctgtttcgg
gcggacatcacctggagcaaggtgatctcgctgtttgccattgccggcggcctgtcggtg
gactgtgtgcggcaggggcatcccgagtacctgcccaagctgatggagagcgtctcggag
gtgattgaggatgagctggtgccctggatcaatgagaacggtggctggagcggcatcaat
acccatgtcctgcccacgacgaacagcttgaatccgctcgagtggacgacgctggtgata
ggtgtggtttttggcctaattctgctttttatgttcttacgttttatagtaagcacgata
ataccgaaaatatatcaacgatttacgaactga

DBGET integrated database retrieval system