KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20938Help
Entry
Dpse_GA20938      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform B
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 4805047
NCBI-ProteinID: XP_001361512
FlyBase: FBgn0080927
UniProt: Q28Y75
LinkDB All DBs
Position
3
AA seq 70 aa AA seqDB search
MDVMSSSLQQQRIVVDQLRREASMERQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNP
FREKSSCTVL
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggacgtaatgtcatcatctctacaacaacagcgcattgtcgttgaccagctgcgtcgc
gaggcgtcgatggaacggcagaccatttcggagtcgtgcgccaaaatgatgaagtatatc
acggagcacgagcaggaggattaccttttgactggattcaccagccagaaggtaaatcca
ttccgtgaaaagtcttcatgcaccgttctttaa

DBGET integrated database retrieval system