KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA24650Help
Entry
Dpse_GA24650      CDS       T01032                                 

Gene name
Dpse_Mal-A4
Definition
(RefSeq) maltase A4
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00052  Galactose metabolism
dpo00500  Starch and sucrose metabolism
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dpse_GA24650 (Dpse_Mal-A4)
   00500 Starch and sucrose metabolism
    Dpse_GA24650 (Dpse_Mal-A4)
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dpse_GA24650 (Dpse_Mal-A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 6898151
NCBI-ProteinID: XP_002138229
FlyBase: FBgn0246039
UniProt: B5DZA1
LinkDB All DBs
Position
3
AA seq 579 aa AA seqDB search
MTTWSSLFLLIGLGLLAVDAAAPWWKTASFYQIYPRSFKDTDGDGIGDLNGVTEKLEYLK
EIGVTATWLSPFLKSPMADFGYDISDFKDVDPLFGDMEDFENMVARAKELNVKIILDFVP
NHSSDECDWFIRSAAGEEKYKDYYIWHPGFVDDNGQRIPPTNWVSVFRGSAWEWHEDRQE
YYLHQFHKKQPDFNFRNPVVREEMNNVLRFWLEKGVDGFRVDAIYHAFEIEADENGNYPD
EPRNDWTDDPDEYGYTHKIYTVDQPETPHLVFEWREILEQFQADNGGDERILMVETWSPI
EIVMDYYGNSTADGAQIPFNFQLISNLHYDSDAYHYEYLINNWLNLMPAGKSANWVIGNH
DKNRVGSRFGADRVDLFNILLLTLPGCSITYNGEEIGMLDGYVSWEDTVDPQACNGYEEN
YMAMSRDPARTPMHWSDDKMAGFTTGSTTWLPVGQDYAERNVKTERGVSLSHLNIFKRLQ
QLRKEPTIEEGSAEIKAVSNYVLAVKRYLSGNYVYISLFNIFDSIENVDLTQVFGGLPAK
FQYALVTKKSIKQVGDQVSASSVTLMPHESIVLRSTTTV
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttggtcgagcctattcctgctgatcggccttggccttctggccgtcgatgcc
gccgctccctggtggaagacagcctcgttctatcagatctatccgcgctcctttaaggac
accgatggcgatggaatcggtgacttgaatggcgtcacagagaaactggaatatcttaag
gagatcggcgtcactgccacttggctgtcgcctttcctcaaatcacccatggccgatttt
ggctatgacatatccgacttcaaggacgtagatccactcttcggcgacatggaggacttt
gaaaacatggttgcccgtgccaaggagctgaatgtgaagatcatcctggatttcgttccc
aatcactctagcgatgaatgcgactggttcatccgctctgctgctggcgaggagaagtac
aaggactactacatctggcatcccggcttcgtcgatgacaacgggcagcgcattcccccc
accaattgggtgagtgtgttccgcggatcggcctgggagtggcatgaggaccgccaggaa
tactaccttcaccagttccacaagaagcaacccgacttcaatttccgcaatcccgtggtg
cgcgaggagatgaacaatgtccttcgcttctggctggagaagggtgtggacggcttccgc
gtggacgccatctaccatgccttcgagattgaggcggacgagaatggcaactatccggat
gagccccgcaacgattggaccgatgacccagatgagtatggctacacccacaaaatctac
accgtggatcagccagagacccctcacctggtattcgaatggcgtgagatcctcgaacag
ttccaagctgacaatgggggcgatgagcgcatccttatggtggagacctggtcacccatt
gagatcgtcatggactactatggcaatagcacggcggatggggcccagataccgttcaac
ttccagttgattagcaatctgcactacgactccgatgcctatcactacgaatacctgatt
aacaactggcttaaccttatgccagctgggaagagcgccaactgggtgattggcaaccat
gacaagaaccgcgtgggctcccgcttcggcgccgatcgggttgatctgttcaacatcctg
ctgctgacgctgcccggctgcagtatcacctacaacggcgaggagatcggcatgctcgat
ggctacgtgtcctgggaggacactgtggacccgcaggcctgcaacggctatgaggagaac
tacatggccatgtcacgcgatcccgctcgtaccccgatgcactggtcggacgataagatg
gctggattcacaaccggatcgaccacgtggttgccggtgggccaagactatgccgagcgt
aacgtgaagacagagcgcggtgtctctctcagccacctaaacatcttcaagcggcttcag
cagctccgcaaggagcccaccatcgaggagggctctgccgagatcaaggcagtcagcaac
tacgtcctggccgttaagcgttacctgagcggcaactacgtctacatttcgctgttcaac
attttcgactccatcgagaatgtggatctgacccaggtgttcggtggtctgcccgccaag
ttccagtatgcccttgtcactaaaaagtccatcaagcaggttggcgatcaggtctcggcc
agcagtgtcaccctcatgccacacgaatccattgtgctgcggtccaccactacggtttaa

DBGET integrated database retrieval system