KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA24980Help
Entry
Dpse_GA24980      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dpse_GA24980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dpo01002]
    Dpse_GA24980
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpo04147]
    Dpse_GA24980
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dpse_GA24980
Peptidases [BR:dpo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dpse_GA24980
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA24980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-GeneID: 6898786
NCBI-ProteinID: XP_002138763
FlyBase: FBgn0246363
UniProt: B5E0C8
LinkDB All DBs
Position
3
AA seq 256 aa AA seqDB search
MLKFVILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSV
YSASIVVTAAHCLQSVSASTLQVRAGSTYWSSGGTVVKVASFKNHEGYNANTMVNDIAVI
RLSSALGLSSTIKAIGLASSAPANGAAASVSGWGTLSYGSSSIPTTLQYVNVNIVGQSQC
ASSTYGYGSEIKSTMICAYSSGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYANYPGVYA
DVAALRSWVVSAASSV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagttcgtgatcttgttgtcggctgtcgcctgcgccctgggaggcaccatccca
gagggtctcctgccccagctggatggccgcattgttggaggcaccgccaccaccattagc
agcttcccctggcagatctccctgcagcgcagtggctcccactcctgcggtggctcggtc
tactccgccagcatcgttgtgaccgctgctcactgcctgcagtccgtgtccgcctcgacc
ctccaggtccgtgccggttccacctactggagctccggcggcaccgtcgtcaaggttgca
tccttcaagaaccacgagggctacaacgccaacaccatggtcaacgacatcgctgtcatc
aggctgagctctgccctgggcctcagctccaccatcaaggctatcggtctggccagttct
gctcccgctaacggtgctgctgcttccgtctccggatggggtaccctgtcgtacggctcc
agctccatccccaccaccctgcagtacgtgaacgtgaacatcgtcggccagtcgcagtgc
gcttcctccacctacggttatggcagtgagatcaagtccaccatgatctgcgcttattcc
agcggcaaggatgcctgccagggtgattccggcggcccattggtctccggcggtgtcctc
gttggtgttgtgtcctggggctatggctgcgcctacgccaactaccccggtgtctacgcc
gatgttgctgctctccgctcctgggtggtcagcgccgccagctcggtctaa

DBGET integrated database retrieval system