KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA26401Help
Entry
Dpse_GA26401      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00040  Pentose and glucuronate interconversions
dpo00051  Fructose and mannose metabolism
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dpse_GA26401
   00051 Fructose and mannose metabolism
    Dpse_GA26401
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Dpse_GA26401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Pyr_redox_2 UDPG_MGDP_dh_N Methyltransf_16 2-Hacid_dh_C Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 6897523
NCBI-ProteinID: XP_002137672
FlyBase: FBgn0247775
UniProt: B5DX70
LinkDB All DBs
Position
2
AA seq 360 aa AA seqDB search
MAKDNLTAVLYGIEDMRLEQRPIPVIADDEVLLAMDSVGICGSDVHYLKEGRIGDFILTK
PMVIGHEAAGVVAKLGKKVTSLKVGDRVAIEPGVPCRYCDLCKQGKYSLCADMVFCATPP
YDGNLTRYYKHAADFCFKLPDHVSMEEGALLEPLSVGVHACRRAGVGLGSRVLILGAGPI
GLVTMLVAQSMGASEILITDLEQHRLDVAKELGAHHTLLQRRDQSAEEVAAIVRRTMSGP
PDRSIDCCGAESSARLAIFATVSSGVVVIVGMGAPEVKLPLINALAREVDIRGVFRYCND
YAAALALVASGKVNVKRLVTHHFDITDTDKAFETSRKGLGGAIKVMIHVQPRNTNNPVKF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggacaatctgacagcagtgctctacggcattgaggatatgcgtttggaacaa
cgtcccattccagtgatagccgatgatgaggttctactggctatggatagtgtgggtatt
tgcggctccgatgtgcactacctcaaagaaggacgcattggtgactttatactgaccaag
cccatggtcattggacatgaggctgccggagttgtggccaaattgggaaagaaggtgacg
agcctgaaggtgggcgatcgtgtggccatcgagccgggcgtaccctgccgctactgtgat
ctctgcaagcagggaaagtacagtctctgtgcggatatggtgttctgtgccactccgccg
tacgatggcaatcttacgaggtactacaaacatgccgcagacttttgcttcaagctgccg
gatcatgtgtccatggaggagggtgccctgctcgagcccctctcggtgggtgtccatgcc
tgtcgtcgtgccggcgtcggtctgggctctcgagtgctcatcctgggcgctggaccaatc
ggtttggtcaccatgttggttgctcaatccatgggcgcctcagagattctcatcacggac
ttggaacaacatcgtctggatgtggccaaggagctgggtgcccatcacacgctcctgcag
aggagggatcaaagcgccgaggaggtggcagcgatcgtacgccgtacaatgtcgggacca
ccggacagatccattgattgctgtggtgccgagagcagtgcccgattggccatttttgcc
actgtttccagcggagttgtggtgattgtgggcatgggtgccccggaagtaaagctaccc
ttgatcaatgccctggcccgtgaggtggacattcgtggtgtcttccgctactgcaatgac
tatgccgctgccttggctctggtggcctccggcaaggtcaatgtcaaacgtctggtgacc
catcatttcgacatcacggacacggacaaggccttcgagacctcgcgcaagggcttgggc
ggtgccatcaaggtgatgattcacgtgcaacccaggaacacaaacaatcccgtcaagttc
tag

DBGET integrated database retrieval system