KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA27501
Entry
Dpse_GA27501      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K19904  synaptotagmin-4
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpo04131]
    Dpse_GA27501
Membrane trafficking [BR:dpo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    Dpse_GA27501
SSDB
Motif
Pfam: C2
Other DBs
NCBI-GeneID: 6897853
NCBI-ProteinID: XP_002137956
FlyBase: FBgn0248867
UniProt: A0A6I8V3Q9
LinkDB
Position
2
AA seq 516 aa
MKRAYICAQNRSTQQLPEGRKIQERLKPNPNPLKMAEEYIPDVSMMDTILPAILGLTAAA
VLSSVACICAKQMRIRNKKQNHHDASFPFQPTRRPTAVRSPSGQPPHYLKKSPSPTNGKQ
MGLLSPMQDQSTSPTAPPNMKYTEEDEVPMQQEQQQQQQQAQQHQMGNKLTVVDGNGMKQ
SLHNHHHSPVETIANGNVTITLDDHALTNGKELVIADQYGKLGTIYFKLRYLAERNALMV
SIIRCRGLPCKGGSGGTGDIPTGMNGRTQAATDPYVKLQLLPDKQHKVKTRVVRNTRNPV
YDEDFTFYGLNINDLQNMSLHFVILSFDRYSRDDVIGEVVCPLSSIEIGDISKEALSISK
EIQPRSLKIRAQGRGELLISLCWQPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYN
GQRIAKKKTHVKKRTLSPVFNESFAFDIPAAEGTGASLEGVSLELMLLDWDRVTKNEVIG
RLELGGPTSSSTALNHWNEVCNSPRRQIAEWHKLNE
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgaaaagagcatacatttgtgcgcaaaatcgatctacgcagcaacttccagagggaaga
aaaatccaagagaggctgaagccgaatccgaatccattaaaaatggctgaagaatacata
ccagatgtcagcatgatggacacaattttgcccgccatattgggactgacggcagctgca
gtcctgtcgtcggtggcctgcatctgtgccaaacagatgcgcattcggaacaagaagcag
aaccatcatgatgcctcattcccattccaaccgacccgacggccgaccgcagttcgatcg
cccagcggccagccgccgcattatctgaagaagtctccatcgccaacgaacggcaagcag
atgggtctgctgtcgcccatgcaggaccagtcgacctcaccgaccgcaccaccgaatatg
aaatacaccgaagaggatgaggtgcccatgcagcaggaacaacaacaacaacagcagcag
gctcagcagcatcagatgggaaacaagctgacggttgtggatggaaacgggatgaagcag
tcgctgcacaatcatcaccattcgccggtggagacgattgccaatgggaatgtgacaatc
accttggacgaccatgccttgaccaacggcaaggagctcgtgatagccgatcagtatgga
aaactgggaacgatctacttcaagttacgctatctggccgagaggaatgccttgatggtt
tcgatcattcgctgccgcggattgccctgcaaaggcggatcgggcggcaccggcgacata
cccactggcatgaacggacgcacacaggcggccaccgatccctatgtgaagctgcaactg
ttgcccgacaagcagcacaaagtgaagacccgcgtggtgcggaatacccggaatccagtg
tacgacgaggactttacattctacggcctgaacatcaacgatctgcagaacatgtcgctg
cactttgtcatactcagcttcgatcggtattcgcgggacgatgtgattggcgaagtggtc
tgcccattgtcctccattgagatcggtgacatttccaaggaggccctctccatcagcaag
gagatccagccgcgcagcctaaagatacgtgcccagggacgaggcgagcttttaatctct
ctctgctggcagccggctgccggacgcctgactgtggtgttgctcaaggcccggaatttg
ccccgtatggatgtcacaggtctggccgatccctacgtgaagatctatctgttgtacaat
ggtcagcgcattgccaagaagaagacgcacgtaaagaagcgcactctgagcccagtattc
aacgagagtttcgcatttgatattcccgctgcagagggcactggcgccagtctggagggc
gtctccctggagctgatgttactcgactgggatcgcgtgaccaagaatgaggtcattggt
cgcctggagttgggtggaccgacatccagcagcaccgccctgaatcactggaacgaggtg
tgcaactccccacgccgccagattgccgagtggcacaaattaaacgagtaa

DBGET integrated database retrieval system