KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA31463Help
Entry
Dpse_GA31463      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11253  histone H3
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Chromosome and associated proteins [BR:dpo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dpse_GA31463
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dpse_GA31463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa PAF
Motif
Other DBs
NCBI-GeneID: 26532883
NCBI-ProteinID: XP_015035137
FlyBase: FBgn0271870
UniProt: A0A0R3NWW5
LinkDB All DBs
Position
Unknown
AA seq 344 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERDGITDNVFQKHFQHSTSFLVDESRDTFYTATTSQTADSGLRDTLD
VITQNLAMTLSASLSQAFATFTTTRIVKMARTKQTARKSTGGKAPRKQLATKAARKSAPA
TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMA
LQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtaccaagcagactgctcgtaaatcgactggtggcaaggcgccgcgcaaacaa
ctggctaccaaggccgcacgtaaaagtgctccagcaaccggaggcgtgaagaaacctcat
cgctatcgccccggcactgttgccctccgtgaaatccgtcgctaccagaagagtaccgag
ctgctgatccgcaaactgcctttccagcgtttggttcgtgaaatcgctcaggatttcaaa
actgacttgcgtttccagagctcggcagtaatggcactccaggaagctagcgaagcctat
ctggtcggtctcttcgaagataccaacttgtgcgccatccatgccaagcgtgtcacaatc
atgcccaaggacatccaactggccagacgtatccgtggcgagcgtgacggcatcacggat
aacgttttccaaaaacactttcagcactccacgagtttcctcgtagatgagtcccgagat
acgttttacaccgccacgacgagccaaacggcggatagcgggcttcgtgataccctggat
gttatcacgcagaaccttgcgatgacgcttagcgcctccctttcccaagcctttgccacc
tttaccacgaccagaatagtgaaaatggcccgtaccaagcagactgctcgtaaatcgact
ggtggcaaggcgccgcgcaaacaactggctaccaaggccgcacgtaaaagtgctccagca
accggaggcgtgaagaaacctcatcgctatcgccccggcactgttgccctccgtgaaatc
cgtcgctaccagaagagtaccgagctgctgatccgcaaactgcctttccagcgtttggtt
cgtgaaatcgctcaggatttcaaaactgacttgcgtttccagagctcggcagtaatggca
ctccaggaagctagcgaagcctatctggtcggtctcttcgaagataccaacttgtgcgcc
atccatgccaagcgtgtcacaatcatgcccaaggacatccaactggccagacgtatccgt
ggcgagcgtgcttaa

DBGET integrated database retrieval system