KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_146669Help
Entry
DICPUDRAFT_146669 CDS       T02090                                 

Gene name
gadA
Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00250  Alanine, aspartate and glutamate metabolism
dpp00410  beta-Alanine metabolism
dpp00430  Taurine and hypotaurine metabolism
dpp00650  Butanoate metabolism
dpp01100  Metabolic pathways
dpp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DICPUDRAFT_146669 (gadA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DICPUDRAFT_146669 (gadA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DICPUDRAFT_146669 (gadA)
   00430 Taurine and hypotaurine metabolism
    DICPUDRAFT_146669 (gadA)
Enzymes [BR:dpp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DICPUDRAFT_146669 (gadA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 10503472
NCBI-ProteinID: XP_003283053
JGI: Dicpu1_146669
UniProt: F0Z6K2
LinkDB All DBs
Position
Unknown
AA seq 473 aa AA seqDB search
MSLHSIKSENTKEKKGNSNKYKRCYDLYAEKSATHPINKYKINDHPTDPDLSKNLILDEL
LLDGNAKQNLATFCQTDVDINIHTLMDKCIDKNMIDKDEYPQTAEIESRCVHMIADLWNS
PDSANTIGCSTTGSSEAAMLGGLALKWKWREQRKKEGKPCDRPNLITGPVQICWHKFVLY
FDIELREIPMENGRLLMSPEEVLKRCDENTIGVVPTLGVTFTLQYENVRAISDALDKYHK
ETGLDIPIHVDAASGGFVAPFITPDLVWDFRLPRVKSINASGHKYGLSPLGVGWVIWRGK
EDIHKDLIFNVNYLGGNMPTFSLNFSRPGGQIVSQYYNFIRHGREGYRAIHQACIDHGVY
IGEEIKKMGIFDLIYDGKGALPGVCWLLKKDAKVKFNLFDLSDRMKTRGWQIASYTLPKN
AESMIITRVLIRHGFSRDMASLLIDDIKRCLEYFEKHPLVKPLSKEEGEGFHH
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtcactacattcaataaaaagtgaaaacactaaggaaaaaaaaggaaattcaaataaa
tataaaagatgttatgatttatatgctgaaaaaagtgcaacccatccaataaataaatat
aaaattaatgatcatccaacagacccagatctttcaaaaaatttaattttggacgagttg
ttattagatggtaatgcaaagcaaaatctagcaacattctgtcaaaccgatgtagatatt
aatatccatactttaatggacaaatgtattgataaaaatatgattgataaggatgaatac
ccacaaactgctgaaatagagtcaagatgtgttcatatgattgccgatctatggaattcc
ccagattcagcaaatacaattgggtgttcaacaactggttcaagtgaggcagcaatgttg
ggtggcttagctttgaaatggaaatggagagaacaaagaaaaaaagaaggtaaaccatgt
gatagaccaaatttaatcaccggtccagttcaaatttgttggcataagtttgttttgtat
ttcgacatagagctaagagaaataccaatggaaaatggccgtttgctaatgtcacctgaa
gaagtcctcaagcgttgtgatgagaatactattggtgttgttccaactctaggtgtaacc
tttacattacagtatgaaaatgttagagccatttcagatgcattagataaataccacaaa
gaaactggtttagatatcccaattcatgtagatgccgctagcggtggtttcgttgcacca
ttcatcacaccagatttagtttgggattttagattaccacgtgtaaagtccattaatgca
tcaggtcataaatatggtttatctccattgggtgtaggttgggtaatctggaggggcaaa
gaagatatccacaaagatttaattttcaatgttaattatcttggtggtaacatgccaact
ttttctcttaacttttcgcgtccaggtggtcaaatagtttctcaatactacaactttata
cgtcacggtcgtgaagggtatagagcaattcatcaagcttgtattgaccatggtgtttac
attggggaagaaattaaaaagatgggaatctttgacttaatttatgatggcaaaggtgct
cttccaggtgtttgctggcttctcaagaaagacgctaaagtcaaatttaatctcttcgat
ctttcagatagaatgaaaactcgtggatggcaaatagcatcatatacactccccaaaaat
gcagagtctatgatcatcactcgtgtcttaatccgtcatggtttcagtcgtgatatggca
tctctacttattgatgacataaaacgttgtttggaatactttgaaaaacacccattagtt
aaacctctatctaaagaggagggtgaaggattccaccattaa

DBGET integrated database retrieval system