KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_147848Help
Entry
DICPUDRAFT_147848 CDS       T02090                                 

Definition
(RefSeq) cystathionine gamma-lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00260  Glycine, serine and threonine metabolism
dpp00270  Cysteine and methionine metabolism
dpp00450  Selenocompound metabolism
dpp01100  Metabolic pathways
dpp01130  Biosynthesis of antibiotics
dpp01230  Biosynthesis of amino acids
Module
dpp_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DICPUDRAFT_147848
   00270 Cysteine and methionine metabolism
    DICPUDRAFT_147848
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DICPUDRAFT_147848
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpp04147]
    DICPUDRAFT_147848
Enzymes [BR:dpp01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     DICPUDRAFT_147848
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DICPUDRAFT_147848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 10510003
NCBI-ProteinID: XP_003284098
JGI: Dicpu1_147848
UniProt: F0Z9K3
LinkDB All DBs
Position
Unknown
AA seq 391 aa AA seqDB search
MTKNTTEIGKYKIGTNVIHAGQAADKNTGAVIVPISLSTTFLQPSPGVLASEYDYSRSGN
PTRKAFEECIAACENAKYGLAFASGLATLTTITHMLKAGDEVISIDDVYGGTRRYFTRVA
SNFDLKFKFVDLATLDQLKEAFTDKTKLVWVETPTNPLLKVADIKAVADYVHSRGAVLVV
DNTFMSPYFQNPLDLGADIVMHSVTKYINGHSDCVMGVLATNNDELYDKLKFLQNSCGGV
PSAFDCFLALRGLKTLHIRMEQHQKNAFALCEFLEKHPKVERVIYPGLPSHPQHELCKRQ
MKGYGGMVVFFVKGGIDQSRAFLENIKIFALAESLGGVESLIELPSVMTHASVPEEERAK
LGITDTLIRLSVGIEDINDLIKDVSQALEKC
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaatactactgaaattggcaaatataagattggaaccaacgttatccacgct
ggtcaagccgccgataaaaatactggtgctgttattgtcccaatttcattatccaccact
ttcttacaaccatccccaggtgttttagcttcagaatacgattattcaagatcaggtaat
ccaactagaaaagcatttgaagaatgtattgctgcttgtgaaaacgctaaatatggttta
gcatttgctagtggtttagctactttaactaccattacccatatgttaaaagccggtgat
gaagtcatttcaatcgatgatgtttatggtggtacacgtagatatttcacccgtgttgct
tcaaactttgacttaaaattcaaatttgtcgatttagctaccttagatcaattaaaagaa
gctttcaccgataaaaccaaattagtttgggttgaaactccaaccaatccactcttaaag
gtcgctgatatcaaagctgttgctgattatgttcacagccgtggtgccgttttagttgtc
gataacaccttcatgtccccatacttccaaaacccattagatttaggtgctgatatcgtt
atgcactctgttaccaaatatatcaatggtcacagtgattgtgttatgggtgttttagct
accaacaacgacgaactttacgacaaattaaaattccttcaaaacagttgtggtggtgtt
ccatcagcttttgattgtttccttgctcttcgtggtctcaagactcttcacattcgtatg
gaacaacatcaaaagaatgcttttgctctctgtgaattcctcgaaaaacatccaaaagtt
gaaagagttatctatccaggtttaccatcacatccacaacatgaattatgcaaacgtcaa
atgaaaggttatggtggtatggttgttttctttgttaaaggcggtattgatcaatcaaga
gctttcttagaaaatattaaaatctttgctttagccgaatcattaggtggtgttgaatct
ttaatcgaattaccatcagttatgacccacgcttcagttccagaagaagaaagagccaaa
ttaggtatcactgatactttaattcgtttatctgttggtattgaagatattaatgattta
attaaagatgtttcacaagctttagaaaaatgttaa

DBGET integrated database retrieval system