KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_38849Help
Entry
DICPUDRAFT_38849  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    DICPUDRAFT_38849
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpp01001]
    DICPUDRAFT_38849
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DICPUDRAFT_38849
Protein kinases [BR:dpp01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   DICPUDRAFT_38849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH PH_11 PH_3 Pkinase_C Kinase-like PH_8 PH_9 Kdo APH DUF3791
Motif
Other DBs
NCBI-GeneID: 10507543
NCBI-ProteinID: XP_003291363
JGI: Dicpu1_38849
UniProt: F0ZVB0
LinkDB All DBs
Position
Unknown
AA seq 442 aa AA seqDB search
MSAPIKHEGYLTKEGGGFKSWKKRWFILRGGDLSYYKTKGETVPLGIIHLNTSGHIKNSD
RKKRVNGFEVQTPSRTYFLCSETEEERTKWIEILIAERELLLNGNKPKKSEKVGVSDFEL
LNLVGKGSFGKVIQVRKKDTGEIYAMKVLSKKHIVEHNEVEHTLSERNILQKINHPFLVN
LNYSFQTEDKLYFILDYVNGGELFYHLQKDKKFTEDRVRYYGAEIVLALEHLHLSGVIYR
DLKPENLLLTNEGHICMTDFGLCKEGLLSPSDKTVTFCGTPEYLAPEVLQGNGYGKQVDW
WSFGSLLYEMLTGLPPFYNQDVQEMYRKIMMEKLTFPHFISQEARSLLELLLERDPEKRL
ADPNLIKRHPFFRQIDWELLFQKKIPPPFIPNVKGSADTSQIDPVFTDEAPSLTMAGECA
LNPQQQKDFEGFTYVAEPEHLR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaccaatcaaacacgaaggttatctcaccaaagaaggtggtggttttaaaagt
tggaaaaaaagatggttcattcttagaggtggagatttaagttattataaaactaaagga
gaaactgtaccattaggtattattcatttaaatacttcaggtcatattaaaaattcagat
cgtaaaaagagggttaatggattcgaagtacaaacaccatcaagaacctattttttatgt
tcagaaacagaagaagagcgtacaaaatggattgaaattttaattgcagaaagagaatta
ttattaaatggaaataaaccaaagaaatcagaaaaagttggtgtatcagattttgaatta
ttaaaccttgttggtaaaggtagttttggtaaggttatccaagttagaaagaaggataca
ggcgaaatctatgctatgaaagttttatcaaagaaacatatcgtcgaacacaatgaggtc
gaacatactttatctgaacgtaatattcttcaaaaaatcaatcatccattccttgtaaat
cttaactatagtttccaaactgaagataaactttactttattctcgattacgttaatggt
ggtgaattattctatcatttacaaaaagataagaaattcacagaagatcgtgttcgttat
tatggtgctgaaattgtattagcactcgaacatctccatttatctggtgttatttataga
gatttgaaaccagagaatcttttactcaccaacgagggtcacatttgtatgacagatttt
ggtctttgcaaagaaggtcttctttcaccatccgataaaactgttacattctgtggtact
ccagagtatcttgcaccagaagttcttcaaggaaacggttatggaaaacaggtcgattgg
tggagttttggttcactcttatatgaaatgcttacaggtcttccaccattctacaatcaa
gatgttcaagaaatgtatcgtaagattatgatggaaaaacttactttcccacatttcatc
tctcaagaagctcgttctcttttagaacttttattagaaagagatccagaaaaacgttta
gctgatccaaatcttattaaaagacatccatttttccgtcaaatcgattgggaattatta
ttccaaaagaaaattccaccaccatttattccaaatgttaagggttcagctgatacctct
caaattgatccagttttcactgatgaagctccatctttaacaatggctggtgaatgtgca
ctcaatccgcaacaacaaaaagattttgaaggttttacatatgttgctgaaccagaacat
ttaagataa

DBGET integrated database retrieval system