KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_39475Help
Entry
DICPUDRAFT_39475  CDS       T02090                                 

Definition
(RefSeq) alanine transaminase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00220  Arginine biosynthesis
dpp00250  Alanine, aspartate and glutamate metabolism
dpp01100  Metabolic pathways
dpp01200  Carbon metabolism
dpp01210  2-Oxocarboxylic acid metabolism
dpp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DICPUDRAFT_39475
   00220 Arginine biosynthesis
    DICPUDRAFT_39475
Enzymes [BR:dpp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     DICPUDRAFT_39475
Amino acid related enzymes [BR:dpp01007]
 Aminotransferase (transaminase)
  Class I
   DICPUDRAFT_39475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 10505475
NCBI-ProteinID: XP_003291733
JGI: Dicpu1_39475
UniProt: F0ZWD8
LinkDB All DBs
Position
Unknown
AA seq 530 aa AA seqDB search
MFRRSLKLLSKETITRVKPNTTIVQPITSSTTVINKNINTFENMQPKKSMTIDNICQNVR
NAQYAVRGELVIRAESISHQLEKQKKEGSKVLPFDEIVYCNIGNPQQLKQKPLTFFRQVV
SLTECPELLDNPYIEKIYPADVIARAREILGSINNTTGAYSSSQGISLVLKSVASFIEKR
DGHPADPSEIFLTDGASTGVQRILKLLIKDRSDGIMIPIPQYPLYSATIELYNGSQLGYL
LNEEKGWSLEVSELERSYNDAVAKGVNPRALVIINPGNPTGQCLDKANMEEVVKFCLNKG
LVLLADEVYQENVYVKEDKPFISFKKVVKDMGGEYADLEMVSFHSVSKGFVGECGKRGGY
MELNGITSDVKAEIYKLASIGLCPNVIGQLVVDLMVRPPTPGDSSYELYIKERDGIYDSL
KKRANLLNKALNSLEGVTCNPSEGAMYAFPQIRLPKKAVEYAQSIGKAPDAYYCIQLLEH
TGICVVPGSGFGQKDGTYHFRTTFLPSEEAIEGVCERIADFHKQFMNKYK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaagaagtttaaaactattaagtaaagaaaccattactcgtgttaaaccaaat
acaactattgttcaaccaataacaagttcaacaactgttattaataaaaatataaataca
ttcgaaaatatgcaaccaaaaaaatctatgacaattgataacatttgtcaaaatgttaga
aatgcacaatatgccgttcgtggtgaattagttattcgtgctgaatcaatttcacaccaa
ttagaaaaacaaaagaaagaaggtagcaaagttttaccatttgacgaaattgtttattgt
aatattggtaacccacaacaattaaaacaaaaaccattaacatttttccgtcaagttgta
tcattaactgaatgcccagaactcttagataacccatatatcgaaaaaatttacccagct
gatgtcattgcacgtgctcgtgaaattttaggttcaattaataataccacaggtgcttat
tcaagcagtcaaggtattagtttagtattaaaatctgttgcttcattcattgaaaagcgt
gatggtcacccagccgatccaagcgaaattttcttaactgatggtgcttcaactggtgta
caacgtattctcaaattattaattaaagatcgttcagatggtatcatgatcccaatccca
caatatccattatacagtgccactattgagctttacaacggttcacaattaggctatctc
ttaaatgaagaaaaaggttggtcacttgaagtcagcgaactcgaacgttcatacaatgat
gccgttgctaaaggtgttaacccaagagctcttgtaattattaatccaggtaacccaact
ggtcaatgtttggataaagccaatatggaagaagttgtcaagttctgtttaaataaaggt
cttgttcttttagctgatgaagtataccaagaaaatgtttatgttaaagaagacaagcca
ttcatttcattcaaaaaagttgttaaagatatgggcggtgaatatgccgatctcgaaatg
gtctcattccactctgtcagtaaaggtttcgtcggtgaatgcggtaaacgtggtggttat
atggaactcaatggtatcactagtgatgttaaagctgaaatctataaactcgcctcaatt
ggtttatgcccaaatgttattggtcaattagtcgttgatttaatggttcgtccaccaacc
ccaggagattcatcatatgaactctatattaaagaaagagatggtatctatgattcactc
aaaaaacgtgctaaccttttaaataaagctttaaattcactcgaaggtgtaacctgtaac
ccatcagaaggtgccatgtatgctttcccacaaattcgtttaccaaagaaagctgtagaa
tatgcccaatcaattggtaaagccccagatgcttattattgtattcaattattagaacac
accggtatttgtgttgttccaggttcaggttttggtcaaaaggatggtacttatcatttc
cgtactactttccttccatcagaagaagctatcgaaggcgtttgtgaaagaattgctgat
ttccacaaacaattcatgaacaaatataaataa

DBGET integrated database retrieval system