KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_48520Help
Entry
DICPUDRAFT_48520  CDS       T02090                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00020  Citrate cycle (TCA cycle)
dpp00190  Oxidative phosphorylation
dpp01100  Metabolic pathways
dpp01110  Biosynthesis of secondary metabolites
dpp01130  Biosynthesis of antibiotics
dpp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DICPUDRAFT_48520
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DICPUDRAFT_48520
Enzymes [BR:dpp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DICPUDRAFT_48520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA DAO Thi4 FAD_binding_3 HI0933_like Dor1
Motif
Other DBs
NCBI-GeneID: 10502197
NCBI-ProteinID: XP_003289320
JGI: Dicpu1_48520
UniProt: F0ZPH1
LinkDB All DBs
Position
Unknown
AA seq 630 aa AA seqDB search
MLSSLRTVSKNIITKNTLNNGILRNFASQQQQYSRDYPVVDHTYDAVVVGAGGAGLRAAL
GLTEKGFKTACITKLFPTRSHTVAAQGGINAALANADDDDWRWHAYDTVKGSDFLGDQDA
IHYMCKEAVPTVLELEQYGVPFSRMEDGRIYQRAFGGQSKNFGKGGQATRCCAAADRTGH
ALLHTLYGQAAKHNTKFFIEYFVTDLIMENGECRGCVAINLEDGTIHRFRSHATILATGG
YGRAYFSATSAHTCTGDGNAMVIRAGLPCQDLEFVQFHPTGIYGSGCLITEGARGEGGYL
LNSAGERFMPRYAPSVADLASRDVVSRSETMEIREGRGVGAEKDHCLLNLTHLSPEIIDE
RLPGIRETAMIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKGQVVNHVNGKDVLVKGLYAA
GESACVSVHGANRLGANSLLDIVVFGRAVANEIGETLAKNTPHKPLQPNAGEESIANIDA
MRFADGTRSTAEIRLEMQKIMQRNAAVFRDGEVLKEGVQLIDKCAKSLKNDIKTTDRTMI
WNTDLIETLELQNLMTQAVLTMHSAEARKESRGAHAREDYKERDDVNWMKHTLSYLDVDT
GKVTLLYRPVVSTTLDESEMESIKPFKRVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgttatcatcactaagaactgtttcaaaaaatattattaccaagaatacattaaacaat
ggtattttaagaaattttgcatcacaacaacaacaatacagcagagattacccagttgtc
gatcatacatatgatgctgttgttgttggtgctggtggtgctggtttaagagcagcttta
ggtttaactgaaaaaggtttcaagactgcatgtatcactaaattattcccaactcgttca
catactgtcgcagcacaaggtggtattaatgccgctttagccaatgccgatgatgatgat
tggagatggcatgcatatgataccgtcaagggtagtgattttttaggtgatcaagatgcc
attcattatatgtgtaaagaagctgtcccaaccgttttagaattagaacaatatggtgtc
ccattcagtcgtatggaagatggtcgtatttatcaacgtgcttttggtggtcaaagtaaa
aattttggtaaaggtggtcaagctacacgttgttgtgccgctgctgatcgtaccggtcat
gctcttttacacaccctttatggtcaagccgccaaacataacaccaaattctttattgaa
tactttgttaccgatttaattatggaaaatggcgaatgtcgtggttgtgttgctatcaat
ttagaagacggtaccattcatagattcagatctcatgctactattcttgctactggtggt
tatggtagagcttacttctctgctacctctgctcatacttgcactggtgatggtaatgct
atggttattagagctggtctcccatgtcaagatttagaatttgttcaattccatccaact
ggtatttatggtagtggttgtttaatcactgaaggtgctcgtggtgaaggtggttatctt
ttaaatagtgctggtgaacgtttcatgccacgttatgcaccatctgttgctgatttagcc
tcaagagatgtcgtttcacgttccgaaaccatggaaattagagaaggtcgtggtgttggt
gccgaaaaagatcattgtctcctcaatcttactcatttatcaccagaaatcattgatgaa
cgtcttccaggtatcagagaaactgctatgattttcgctggtgttgatgttaccaaagaa
ccaatcccagttattccaaccgttcattacaatatgggtggtatcccaaccaactacaag
ggtcaagttgttaaccacgtcaatggtaaagatgttttagttaaaggtttatatgctgct
ggtgaatctgcttgtgtctctgttcacggtgctaatcgtttaggtgctaactcactctta
gatatcgttgttttcggtcgtgctgttgccaatgaaatcggtgaaacccttgccaagaat
actccacacaaaccactccaaccaaatgccggtgaagaatcaattgccaacattgatgct
atgcgtttcgccgatggtacccgttcaactgctgaaattcgtcttgaaatgcaaaagatt
atgcaaagaaatgctgctgtctttagagatggtgaagtcctcaaagaaggtgttcaatta
atcgacaaatgtgctaaatcacttaaaaacgatatcaaaacaaccgatcgtactatgatt
tggaacactgatttaatcgaaactttagaactccaaaatcttatgacccaagccgtatta
actatgcactctgctgaagctcgtaaagaatcacgtggtgcccatgctcgtgaagattat
aaagaaagagacgatgttaactggatgaagcacaccctttcatatttagatgttgatact
ggtaaagttactcttctttatcgtccagtagtttcaacaactttagatgaatcagaaatg
gaatcaatcaaaccattcaagagagtttactaa

DBGET integrated database retrieval system