KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_51401Help
Entry
DICPUDRAFT_51401  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DICPUDRAFT_51401
Enzymes [BR:dpp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DICPUDRAFT_51401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N CesT
Motif
Other DBs
NCBI-GeneID: 10506329
NCBI-ProteinID: XP_003294247
JGI: Dicpu1_51401
UniProt: F1A3K8
LinkDB All DBs
Position
Unknown
AA seq 223 aa AA seqDB search
MLGRSIKSVQKLQSIRAFTNATNSYTLPDLSYDYGALAPVISPEIMTLHHKKHHQTYVNN
LNIALDKYAKAEAAKDVAQMIALQSAIKFNGGGHVNHSIFWTNLAPKNQDGGVAPSGPLI
NAINKQFGSIDNLIKKMTDQTVAIQGSGWGWLGYDKAEDRLVIQTQQNQDPLSVSGFTPL
LGIDVWEHAYYLDYKNVRADYVKNIWQIVNWKNVAQRYEAAKN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgttaggacgttcaattaagtcagttcaaaagctccaatcaattagagctttcaccaat
gctaccaactcatacactcttccagatctctcatatgactatggtgctctcgcaccagta
atttcaccagaaattatgacccttcatcacaaaaaacatcatcaaacctatgttaataat
cttaacattgctttagataaatatgctaaagctgaagctgctaaagatgttgcccaaatg
attgctctccaaagtgctattaaattcaatggtggtggtcatgttaaccattcaatcttt
tggaccaatttagcaccaaaaaaccaagatggtggtgttgctccaagtggtccattaatc
aatgctatcaataaacaatttggttcaattgataatttaattaaaaaaatgactgatcaa
accgttgctattcaaggttcaggttggggttggttaggttatgataaagctgaagatcgt
ttagtcattcaaacccaacaaaatcaagatccactctcagtctctggttttactccatta
ttaggtattgatgtttgggaacatgcctattatcttgactacaaaaatgttagagctgat
tatgtaaagaatatttggcaaatcgtcaactggaagaatgtcgcccaaagatatgaagca
gccaaaaactaa

DBGET integrated database retrieval system