KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_55132Help
Entry
DICPUDRAFT_55132  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00010  Glycolysis / Gluconeogenesis
dpp00030  Pentose phosphate pathway
dpp00051  Fructose and mannose metabolism
dpp00052  Galactose metabolism
dpp01100  Metabolic pathways
dpp01110  Biosynthesis of secondary metabolites
dpp01130  Biosynthesis of antibiotics
dpp01200  Carbon metabolism
dpp01230  Biosynthesis of amino acids
dpp03018  RNA degradation
Module
dpp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICPUDRAFT_55132
   00030 Pentose phosphate pathway
    DICPUDRAFT_55132
   00051 Fructose and mannose metabolism
    DICPUDRAFT_55132
   00052 Galactose metabolism
    DICPUDRAFT_55132
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    DICPUDRAFT_55132
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpp01009]
    DICPUDRAFT_55132
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dpp03019]
    DICPUDRAFT_55132
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DICPUDRAFT_55132
Protein phosphatases and associated proteins [BR:dpp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DICPUDRAFT_55132
Messenger RNA biogenesis [BR:dpp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DICPUDRAFT_55132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 10501293
NCBI-ProteinID: XP_003287952
JGI: Dicpu1_55132
UniProt: F0ZKK2
LinkDB All DBs
Position
Unknown
AA seq 782 aa AA seqDB search
MSTKDIKRIAVLTSGGDSSGMNPAIRAFARAAMLKGAEVFAIREGYNGLVNDSILPLNWG
SVAGIISRGGTIIGTARSAEFRTREGRKKAAFNLIKNKINNLLVIGGDGSLTGANLLRSE
WCSLLGELVNDGKISPDCLENYSTLSIAGIVGSIDNDMCGTDLTVGADTATRRILEAIDS
ILSTAVSHQRSFVIEVMGRNCGWLALVSGVATGADYILIPESPPEKGWEQHMADNLEKGR
LSGRRCSLVIVSEGAIDSDGKPITSSYVRQFLEDKGHDARITILGHVQRGGTPTFLDRYI
ATIMGVESANYFYDTKEAQKEPVLIGMSGTDVIRSPLMECVKKTQSIATLIKEKRFNEVV
DCRGGMFKEFHEIFRACSNLYRRKVEPNGLNIVILHSGGPSPGMNPCVRAFTRLGIDRGY
TMYGCFNGFGGLALGEIQQLNWMTVNGWSVMGGAELGTNRSVPNDSNIDAIMANLEKLKI
DAILMFGGFNGYLGIAKLYEYREKYPRLKKISIIGAPGTIANNVPGTNISIGADTSLNNT
LDALDKIKQSAVASRRLFVVEVMGAHCGYLAAMSSLASGAERSYIMEKGVTLESLTKDLK
MFVERFKREHRIGLIIKSESASPTYTTHFIYSLFKEEGKHLFDVRESILGHLQQGGSPSA
IDRIFSTRLMNHYFEFLEKDLKENNHLQMSGCIGFIDGGVHFTPMPEMIEEMSDKYRRPR
SQWWMDLVDISQNISVFPLDDPSIFNPPNLNDLGRPKSHEISSPTSYSQKSFDPNVNPQF
TL
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactaaggatattaaaagaattgcagttttgacaagtggtggtgattcaagtggt
atgaatccagctataagagcatttgcaagagcagccatgttgaaaggagccgaagtattt
gcaattcgtgaaggttataatggtttagttaatgactcgattttaccattaaattgggga
tctgtagcaggtattattagtagaggtggaacaattataggtacagcaagaagtgcagaa
tttcgtacacgtgaaggtagaaagaaagccgcattcaacttaattaaaaataaaatcaac
aatcttttagtcattggtggtgatggtagtcttacaggtgccaatttacttcgtagcgaa
tggtgttcattattgggtgaacttgtaaatgatggtaaaattagtccagattgtttagaa
aactattcaactctttcaattgctggtatcgttggttcaatcgataatgatatgtgcggt
actgatttaacagtaggtgctgatactgctactagaagaattttagaggctatcgattcc
attcttagtactgctgtaagtcatcaaagaagttttgtaattgaagttatgggtagaaac
tgtggttggttagcattggttagtggtgttgctactggtgccgattatattttaattcca
gaatcaccaccagaaaaaggttgggagcaacatatggctgataatctcgaaaagggtcgt
ctctctggtagaagatgttcattagttattgtatcggaaggtgctatcgatagcgatggt
aaaccaattacctcatcatatgtcagacaatttttagaagataaaggtcacgatgctaga
atcacaattttaggtcatgttcaaagaggtggtactccaacatttttagatcgttatatc
gccaccattatgggtgtcgaatcagccaactatttctatgacaccaaagaggcacaaaaa
gaaccagtattaattggtatgagcggtacagatgtaattagatcaccattaatggagtgt
gtaaagaagactcaatcaattgccacattaatcaaagagaaacgtttcaacgaagttgtc
gattgcagaggtggtatgtttaaggaattccatgaaatctttagagcatgttcaaatctt
tatcgtcgtaaagtcgagccaaatggtctcaatatcgttatccttcatagtggtggtcca
tcaccaggtatgaatccatgtgttcgtgctttcactcgtttaggtatcgatcgtggttat
acaatgtatggttgctttaatggatttggtggtttagctttaggtgaaattcaacaatta
aattggatgactgtcaatggttggtccgttatgggtggtgctgaacttggtaccaatcgt
tcagttccaaacgattcaaatatcgatgctattatggccaatttagaaaaacttaaaatc
gatgcaattttaatgtttggtggtttcaatggctaccttggtattgctaagctctacgaa
taccgtgaaaaatatccaagattaaagaaaatatcaattataggtgctccaggtaccatt
gcaaataatgtaccaggtaccaatatcagtattggtgctgatacttcactcaataacact
ttagatgctttagataaaatcaaacaatcagctgtcgcatctcgtcgtcttttcgttgtc
gaagttatgggtgctcattgtggttatcttgcagccatgagctcattagcatcaggtgcc
gaacgttcatatattatggaaaaaggtgtaacattggaatcattaaccaaagatcttaaa
atgtttgtcgagcgtttcaaacgtgaacacagaatcggtctcatcattaaaagtgaaagt
gctagtccaacctatacaactcatttcatctattcactctttaaagaagaaggtaaacat
ctctttgatgtacgtgaatcaattttaggccatttacaacaaggtggttcaccatcagcc
attgaccgtattttctcaactcgtttaatgaatcactatttcgaatttttagaaaaagac
ttaaaagaaaacaatcatctccaaatgagtggttgtattggtttcatcgatggtggtgtt
catttcaccccaatgcctgaaatgatcgaagaaatgtctgataaatatagacgtccacgt
tctcaatggtggatggatttagttgatatctctcaaaatataagtgttttcccattagac
gatccatcaatttttaatcctccaaatttaaatgatttaggtagaccaaaaagtcacgaa
attagctctccaacatcttactcacaaaaatctttcgatccaaatgtaaatcctcaattt
acactttaa

DBGET integrated database retrieval system