KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_55676Help
Entry
DICPUDRAFT_55676  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00500  Starch and sucrose metabolism
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DICPUDRAFT_55676
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DICPUDRAFT_55676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase GHL6
Motif
Other DBs
NCBI-GeneID: 10499468
NCBI-ProteinID: XP_003288863
JGI: Dicpu1_55676
UniProt: F0ZN65
LinkDB All DBs
Position
Unknown
AA seq 470 aa AA seqDB search
MYNKFVKVFLIAFIAINCVFAGTPDEWSTRTIYQLLTDRFSQTVNSSQPCSNLQSYCGGT
FQGIENHLDYILGMGFDAIWISPVVTNTPGGYHGYWQENIYTINEYFGSEEDLLALIKAC
HSRGIWVMLDVVGNHVGPVNYEYNTIVPFDSPAHYHNCTTCPEDCTINNFDDYTQVEVCR
LSGLPDLDQDNAFVRSTLLNWIKNVTSFYGFDGIRIDTVPEVKAEFWTEYNQAAGVYAVG
EVYNGNLTYVAEYQGPVDGVLSYPMFFTLRNVFASKQSMTQIQATFQQYQQLFKNISYLG
TFIDNHDQVRFLNEQVDVELYKNAITYVLMAQGIPIIYYGTEQGFDGSADPNNREPLWTT
QFNQNSVLYKFIQTINEFRTQNDEVKSAEQIQRYADNGFYAFTRGNAFIALTNGGSVQVQ
TSRVITYHPYDEGTTLCNIFWPTQDCIKVSGGQFTVYLDYGESKIYYPLS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtataacaaatttgttaaagtatttttaattgcttttattgcaattaattgtgtattt
gcaggaacaccagatgaatggagtactagaactatttatcagttattaactgatagattc
agtcaaactgtcaatagttcacaaccatgttcaaaccttcaaagttattgcggtggtaca
ttccaaggtattgaaaatcatttagattatatcttgggtatgggcttcgatgccatctgg
atttcaccagttgttaccaatactccaggtggctaccacggttattggcaagaaaatatt
tacaccatcaatgaatattttggctcagaagaagatttattagcattaattaaagcttgt
cacagtcgtggtatttgggttatgttagatgttgttggtaatcacgttggtccagttaac
tatgaatataatactattgtaccatttgactctccagctcactatcacaactgcaccact
tgcccagaagactgcaccattaataactttgatgattacactcaagtcgaagtctgtcgt
ctttcaggtttaccagatttagatcaagacaatgcttttgttcgtagtaccttattaaac
tggattaaaaacgtaacttcattctatggtttcgatggtattcgtatcgatactgttcca
gaagttaaagctgaattctggaccgaatacaatcaagctgctggtgtttacgctgttggt
gaagtttataacggtaacttaacctacgttgctgaatatcaaggtccagttgacggtgtt
ctttcatacccaatgttctttactcttcgtaatgtctttgcttcaaaacaatcaatgacc
caaattcaagctaccttccaacaataccaacaactcttcaaaaacatctcttatttaggt
acctttattgataaccacgatcaagttcgtttcttaaatgaacaagtcgatgttgaactc
tacaaaaatgctatcacctacgtcttaatggctcaaggtatcccaatcatctactatggt
actgaacaaggtttcgatggttcagccgatccaaacaatcgtgaaccactttggaccact
caattcaatcaaaattcagttttatacaaattcatccaaaccatcaatgaattccgtact
caaaatgatgaagttaaatctgctgaacaaatccaacgttatgctgataatggtttctat
gctttcactcgtggcaatgcttttattgctcttaccaatggcggttcagttcaagttcaa
acctcacgtgttatcacctaccatccatatgatgaaggaactaccttatgtaacattttc
tggccaactcaagattgtatcaaagtatccggtggtcaattcactgtttatttagattac
ggtgaatctaaaatttactacccactctcataa

DBGET integrated database retrieval system