KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_78990Help
Entry
DICPUDRAFT_78990  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 10501587
NCBI-ProteinID: XP_003288180
JGI: Dicpu1_78990
UniProt: F0ZL82
LinkDB All DBs
Position
Unknown
AA seq 267 aa AA seqDB search
MNNKINKIKINVNKINLSASYIQILHNLFDVNYMYSRSLIPQQSNKTISYHFQVNKDNRS
ISYLVLNPTDIQTLNEIDVNDLLNNFLIQFYNYNLNKECFIIIETTINGFTSNTKKNIKS
NIENKYELNKFQLKYFNFNINFLFSQSINETFELMLKSLDNNSNKNSSGETESLLETQKD
IANSLFSNTNKIKLILSTNNISIADSKILLKENQYQISYIMASLEKFKKETKNNNNNNNS
NSNNHNNNENFKETNKSINCFSNNLIK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaaataaataaaataaaaataaatgtcaataaaatcaatcttagtgcttca
tatattcaaatattacacaacctatttgatgtaaactatatgtatagtagaagtttaata
ccacaacaatcaaacaaaacaatctcatatcattttcaagttaataaagataacagatct
atatcatatttagtattaaatcccacagacatccaaacattaaatgaaatcgatgtaaac
gatttattaaataattttttaattcaattttataattataatttaaataaagaatgtttt
attattatagaaacaacaattaatggctttacatcaaatactaaaaagaacataaaatca
aacatcgagaataaatatgaactaaataaatttcaattaaaatattttaattttaatata
aactttcttttttcacaaagtatcaacgaaacttttgagctaatgttaaaatctttagat
aacaatagtaataaaaatagttcaggcgaaaccgaatccctcttagagacccaaaaagat
atagcaaactctttgttttcaaacaccaataaaattaaattaatattatcaacaaataat
ataagcattgcagattctaaaatattattaaaagaaaaccaatatcaaatatcttatatt
atggcatccctcgaaaaatttaaaaaagaaactaaaaacaacaataacaataacaatagt
aatagcaacaaccataataataatgaaaattttaaagaaacaaataaatctataaactgt
ttttcaaataatttgatcaaataa

DBGET integrated database retrieval system